clothes Word Searches

Baby Word Search 2024-05-11

65 Items: bibnaptoyoilcoosburpmilkbathfoodsippypottybinkycrawlswinglaughwipessleepshoessocksinfantcryingdiaperbottlecuddlerattlemobilebabbleonesiecradlepacifyrubberblockscooinglotionpowdershowertoddlernewborngigglesnurseryblanketswaddlebouncerrockingplaypenlullabyformulateethersnugglegurglesstuffedbootiesplaymatmonitorcarriershampooclothesnurserypacifier...

Batel’s chaotic life 2024-10-10

66 Items: AudiDiorLeviTacoFaceNikeAuntMallBatelShaniChanaHavocChaosCohenPradaPillscheckAryasMoneyChaneltoledoMakeupBalletSocialSisterIsraelDarbekDabushLimilooAloyogaNetflixMistakeTherapySephoraNetanyaReadingClothesReturnsMonsterLizardsIguanasOffwhiteAnnoyingLipstickSkincareIsittrueSmolanitLevontinItaylevyOmeradamIsittrueTochenetDesignerTherapistDoughnuts...

Deepavali 2024-10-30

31 Items: Oil-lampsSacred-fireNew-clothesGood-companyHarvest-timeEarthen-lampsDiya-lightingSibling-giftsTemple-visitsNew-beginningsGood-over-evilHouse-cleaningSocial-harmonyGoddess-LakshmiRangoli-designsWorship-ritualsPuranic-legendsExchanging-giftsDivine-blessingsFamily-gatheringsSpiritual-ritualsLight-decorationsFestival-of-lightsTraditional-sweets...

Sweater Word Search 2025-06-22

12 Items: A light coat for fall daysSomething you wear on your headSoft things that go on your feetLong clothes that cover your legsA warm shirt you wear in cool weatherShoes you wear when it's wet or muddyWarm hand covers with no finger holesA thick layer to keep you warm outsideA part of a jacket that covers your head...

XXXI 2024-09-30

21 Items: bombon food labelthis is unjusteternal slumberclothes are thisfull of life, huzzah!like a cloud, huzzah!to cause to catch on fireused to burn unwanted objectsole thee ablaze by thee cinderburned for the smell like incenseburned for the smell like a candlearrange by specific characteristicsblock from public display (very cringe)...

67 Things for Rosie 2025-12-23

67 Items: tvruntanAdygymMaxpinkshopsingsnowsweetPiperJulieNorahdanceSonicRoaryMapleHowdysleeplaughappleBrownTylerTaylorClaireIphoneSawyerAmeronTargetGrinchSophieyellowAggiesGunnerBrookshoodielaptopRebeccaRudolphclothesKaleighdrivingsixteenperfumeproteinMcKennacoconutvanillachargerNewYorkMcKinleesneakersblanketsDrPepperbroccolislippersColoradodingaling...

Travel essentials 2025-09-07

60 Items: AidGumMapPenBookCombCardCardPlugSoapVisaFlopsMoneyPhoneRazorShoesSocksTowelCameraJacketPillowPillowSnacksTicketAdapterAirlineBatteryBlanketChargerClothesCompassCustomsLicenseEarbudsJournalLuggageShampooBackpackBandagesEarplugsMedicineNotebookPassportSuitcaseDeodorantDocumentsGuidebookHairbrushSanitizerInsuranceItineraryMouthwashSunscreenDirections...

End of year 2025-12-15

67 Items: tiesixsadshybeltsuitcoatbillmenulazytillboredbeardwindyfoggysalesliftsgatessevenshelfhappyfunnyhoteltiringheightcloudyabroadcameraflightrelaxedhelpfulcampingclothespaymentwebsiteauctionaccounttrolleycustomslayoverreceiptsnowmanhelpfulclothesnecklacefriendlysunbathecheckoutarrivalsterminaldutyfreecustomerluxuriousvaccumingtalkativeextroventsouvenirs...

Words 2026-03-26

64 Items: MranywhoeyeoldMrscoldholddoorpassgoldpastfindlastbathpathfastmosttoldsurebothevenmindwildkindhourbusyhalfmoveonlypoormanyclassgrassaftereveryplantflooragainchildwaterprovegreatmoneysugarwouldcouldwholebreakclimbsteakbehindshouldfatherprettypeoplebecauseparentsclothesimprovechildreneverybodybeautifulChristmas

Good morning 2026-04-05

10 Items: washing upwake up frommorning mealmorning lightbrush it neatlet the sun into brush your teethput on your clothessound that wakes you upput your bed back together

Los verbos reflexivos CP2 U2 2025-10-27

14 Items: to washto shaveto batheto brushto showerto get upto wake upto dry offto take offto go to bedto say goodbyeto fall asleepto put on makeupto put on (clothes, shoes, etc)

Climate Change 2023-04-20

69 Items: gasairiranwastechinaindiajapanearthsteelnoisewaterheavycrisisrussiaenergyswedenfrancenorwaysectorcarboncementcottonimpactseverestormsclimategermanydenmarkfinlandicelandirelandheatingforestsreleaseclothesdroughtincreaseplasticsrainfallfootprintindonesiacostaricosocietieschemicalstransportsyntheticpolyesterpollutionemergencyprocessingsouthkorea...

Chores and Requests 2025-10-21

10 Items: IronDishesLaundryClothes_______ open the window, please?Could you _______ the living room?_______ you party this weekend, dude?_______ I go to the toilet, Mrs Paige?Could you _______ dinner tonight? I'll be busy.Could you _______ a painkiller at the drugstore for me?

Body Image and Media 2024-04-06

70 Items: tvtvgymabshotbodyfacedietuglylovemediaflawsphonetrendimageshapeuniquementalhealthhauorasocialweightgenderskinnysexualenergytiktokfiltersfashionsocietyclothesmusclessurgerypositivenegativefeelingsthoughtsphysicalfeminineskincaremakeoversnapchatmagazinesinfluencephotoshopcognitivespiritualemotionalselfworthaestheticmasculinebeautifulwaistline...

Whitetower Village 2024-05-07

26 Items: caféhotelcinemabakeryfloriststadiumtoy shoppet shoppizzeriabookshopopticiangame shopshoe shopsweet shopkebab shopminimarketfruit shopsports shopclothes shopfootball shopcar hire shoptravel agencysports centreice cream shoppolice stationworld products shop

Giant High-Frequency Words Wordsearch! 2025-03-10

70 Items: twowhoanyairwhyflyawaymoreoverlongworktookbeenhomeonlymanyknowgoneeachoncemostgrowthesebeganagainroundnightnevermagicsmallaftergoingotherwouldthinkeveryrightstillfoundlivedplacebirdsgreatcriedriverlikedgiantwhichthingswantedaroundbetteracrosscomingjumpedbeforeinsideanimalsshoutedthroughthoughtlaughedanothermorningfriendsbecauseclotheseveryone...

Daily objects en español? 2026-02-22

34 Items: BedKeyPenSofaDoorLampBookForkSoapTableChairClockGlassPlateSpoonKnifePhoneMouseBrushTowelShoesWindowPencilBottleScreenRemoteMirrorClothesNotebookBackpackComputerKeyboardHeadphonesTelevision

Angry Word Search 2026-01-28

5 Items: means feeling madmeans loose clothesis worn around the waistmeans to cook using an ovenmeans to say yes to something

Clothes and Months (left to right and top to bottom) 2026-02-23

30 Items: mayhatcaptiejunejulybeltcoatmarchaprilshirtshoesskirtsocksdressaugustshortstshirtjacketglovesjanuaryoctoberuniformglassesfebruarynovemberdecembertrousersseptemberunderwear

Acostarse Word Search 2025-04-02

11 Items: - to dry- to wash- to brush- to get up- to wake up- to take a bath- to take a shower- to put on make up- to dress yourselfto lie down; to go to sleep(me pongo) - to put on clothes

Ghoulia making friends can be scary 2023-01-28

74 Items: catOUThideskinpalegirlplayoopsideajoincoatmanorpartsatticfancyruleswallstricktreatpartywitchparisgroupdanceauntiezombiegardenmakeuppowderglovesspidershadowspyingtrendyeurekabasketcarvedspookysweetsghouliatragedyfriendsvillageclothesfaintedcostumeexcitedsnoringherselfmemberschildrenmonstersdepartedhairpinswardrobescreamedunstitchpumpkinsordinary...

Body Image and the Media 2024-04-06

69 Items: tvgymhotabsbodyfacedietcareuglymediaflawsphonetrendimageshapeuniquetiktokmentalhealthhauorasocialweightgenderskinnysexualenergyfilters- WorthShamingfashionsocietyclothesmusclessurgery- EsteempositivenegativesnapchatfeelingsthoughtsphysicalDisorderfemininemakeovermagazinesinfluenceinstagramphotoshopaffectivecognitivespiritualemotionalaesthetic...

questions and places 2026-04-08

5 Items: Where do you study?Where do you sleep?Where do you eat food?Where do you buy clothes?Where do you ride a bicycle?

Abeka Grade 7 List #22 2026-04-10

29 Items: busytrulyaffectcoarsecourseexceptminutesurelycertainclothesforeigngrammarcalendarprobablyproceduresecretaryWednesdayconfidenceprofessionalhighest point, peakto provide, furnish, supplyindiscernible, unnoticeableinactive, immobile, motionlessindependent, distinct, separateto stay clear of, avoid, sidestepto repeatedly attack, afflict, vex...

Romans Word Search 2023-08-31

12 Items: BEFORE CHRISTMOST FAMOUS ARENAMAIN ROMAN CLOTHESANCIENT CALCULATORRICH PEOPLE LIVED INKIDS WROTE WITH THEMKIDS IN SCHOOL SPOKEPEOPLE WHO LIVED IN ROMEROME FIRST KING´S BROTHERWHERE POORER PEOPLE LIVEDPEOPLE OWNED BY OTHER PEOPLEROMANS USED THEM TO DECORATE

6B 2026-01-23

22 Items: ifcleanmoneygarageto liveto helpto dustfar frombathroombasementa momentto vacuumdining roomhome officethird floorground floorto cut the lawnto feed the dogto set the tableto wash the dishesto wash the clothesenough; rather; quite; plenty

P4 2026-04-06

25 Items: (orange)rojo(red)gorra(hat)feo (ugly)azul (blue)traje (suit)grande (big)jeans (jeans)falda (skirt)botas (boots)abrigo (coat)verde (green)ropa (clothes)camisa (shirt)pequeño(small)vestido (dress)zapatos (shoes)bufanda (scarf)gafas (glasses)bonito (pretty)morado (purple)sudadera (hoodie)amarillo (yellow)pantalones (pants)calcetines (socks)

2-2 Vocab Word Search 2025-05-21

20 Items: Used to store booksUsed to cover the floorWhere dishes are washedThe room where you sleepWhere your meals are madeYou constantly walk on itUsually used to hold clothingYou turn it on to watch a moviePut on the walls to help decorateOn top of your room theres the...Where you put paintings or postersWhere pots and pans go while cooking...

List 22 2024-10-24

30 Items: busytrulyaffectsurelycoarsecourseexceptminutecertainclothesforeigngrammarcalendartogetherprobablywednesdaysecretaryprocedureconfidenceprofessionalhighest point, peakindiscernible, unnoticeableto provide, furnish, supplyinactive, immobile, motionlessindependent, distinct, separateto stay clear of, avoid, sidestepto repeatedly attack, afflict, vex...

List 22 2024-10-24

30 Items: busytrulyaffectsurelycoarsecourseexceptminutecertainclothesforeigngrammarcalendartogetherprobablywednesdaysecretaryprocedureconfidenceprofessionalhighest point, peakindiscernible, unnoticeableto provide, furnish, supplyinactive, immobile, motionlessindependent, distinct, separateto stay clear of, avoid, sidestepto repeatedly attack, afflict, vex...

Habit Word Search 2025-10-12

5 Items: Lazy shoes?John in LondonWork clothes for a nunThey hang around the house in winterPianos have black ones and white ones

BSC word search 2024-05-03

13 Items: almosthave tospread outhandwritingdoing thingssearched throughmeeting expectationsgroup of reinforcementgetting your body to wake upchild or children in japaneseto wash something off with waterprotects you from getting your clothes messyneeding supervision in the hospital at all times

Suitcase Word Search 2026-01-03

7 Items: Boy, do I miss him.We have a layover here.luggage + clothes holderThis _______ is uncomefortable.Coolest person you'll ever meet.my Swiss knife looks mighty shinyWow! Eleanor's last year of high school.

E1C5 2024-10-23

31 Items: mymappenwhodeskbookwhatalsochairtablewherea lotbinderlockerpencilbookbagwe, ouris goodcomputernotebookclassroomblackboardsmartboardgrade levelgym clothesclock, watchwater bottlethere is/areplural markerthere is/are notand (connecting two nouns)

Year 4 Words, WordsSearch 2024-11-21

20 Items: MinuteBelieveregularPromiseQuarterStrangeCalendarProbablyPossibleQuestionStraight- Clean clothes- Known by many people- the month after January- When you know a lot of things- what you call your fanourite thing- when you don't give up on something- A peice of land , that lives on water- The thing that makes sick people get better...

Vocabulario 2026-01-27

22 Items: cleandirtymoneychoresenoughto giveto dustto livekitchena momentto vacuumif,wetherto receiveto put,placeto feed the fogto make the bedto wash the carto set the tableto wash the dishesto wash the clothesto clean the bathroomto take out the trash

Messy Church 2025-08-30

77 Items: GoIllDieTwoGodAskSonManBadYouOutLetHimMaryLordMoreDaysWakeDiedDeadFourHomeGiveLifeWeptTombCaveSentLoudComeFaceJesusJudeaAngryUpsetNeverGraveLovedSightBlindDyingStoneSmellGloryThankVoiceClothUntieFriendFallenAsleepBuriedAskingHeavenFatherListenAlwaysLazarusBethanySistersMartharMessageTeacherNaturalComfortBrotherBelieveMessiahVillageRushingWeeping...

Random Word Search #1 2025-03-05

75 Items: meohlayjoyearjawexitreadformgolffairvaindarkmenuwaveneckawardcrosscabintigerforgeampleorbittraintableemboxchaosditchironyeaglefairygreenblamegossipplanetinvitepreachschoolpardonsafariseasondollarcunningclothesclimategarbagesausagedespisechickencaptainsuspectdeclinemessagequarterpyramiddignityevaluatemarriagemultiplyideologyinstinctperceiveadvocate...

Here We Go Round the Mulberry Bush 2024-10-20

4 Items: Lastly, we _____ our clothes.After that, we ____ our teeth.We ____ our hair to look good.Upon waking up, we ____ our face.

123 2025-06-07

8 Items: I put flowers in a ___I eat soup with a ____My ____ says "welcome"I eat pasta with a ____I put clothes in a ____I drink tea from a ____l I eat soup from a ____I drink cola from a _____

123 2025-06-07

8 Items: I put flowers in a ___I eat soup with a ____My ____ says "welcome"I eat pasta with a ____I put clothes in a ____I drink tea from a ____l I eat soup from a ____I drink cola from a _____

JUST WORDS WORD PATTERN WORDS 2024-05-10

12 Items: shop hereto run awaybright colora baby horseout of controla home on the waterto have been singingworth a lot of moneya place to save moneyto give a warm greetingput on clothes for the dayrepresents a team or something else

trs23 ver2 u10 2022-11-04

10 Items: not cleanall the thingsput toys in thisput things in thiswhere something iswe put books on thiswe wear these on our feetwe put our clothes in thiswe put dirty dishes in thisa table for studying and working

Power Word Search 2025-12-08

15 Items: Not weakHaving optionsPeople in chargeClothes and styleA scented productA job or work lifeBelief in yourselfBeing treated the samePeople coming togetherGirls supporting girlsMaking things differentStrength women fight forWhat women protested forWhat women use to speak upWhat women won in elections

Paredroja Word Search 2024-09-20

15 Items: Next toBig bedRed wallOn top ofPurple rugBig bedroomAlarm clockSmall closetGreen curtainsGrey wallSSSSSSIt is a small tablePut your clothes in here.What might hang on a wallIf you want to look at yourself, use this.One place that you can put books and picture frames.

Week 12 2023-12-19

80 Items: dietiefewlostsentedgefeltbodygavepageninelivecentcitythindeadheadpushgoldsigngrasswrongcrossmatchhappyfiftyemptyjudgefunnyphonesixtyfancyrockssorryangryfieldwouldbreakfloorchiefshoessincedishesbringssticksbridgeplentyforestislandfamousmotioncornerinsidechangepencilstrongbrokenhungryschoolshouldprettychanceexceptcenterplannedsittingmissingscratch...

Spanish Vocab, Emotions and Describe Your Daily Routine 2024-10-28

16 Items: to get upto wake upIt scares meto go to bedWhat a shame!to take a bathto dry oneselfto get dressedI would love toIt makes me cryto wash oneselfto take a showerIt makes me laughto put on clothesto brush ones teethI am overcome with emotion

Word Search 2023-09-01

81 Items: airwoodhangplaythinwindhornasiagongplustidystayrulestonemetalthumbsoundindiasitarequalordersliceminusunderfloormessycausestatuefamousinsideartistcreatemovingmobilestringfiddleviolinmarblebesideclosetfollowamountmuscledamagemusicalbuzzingsimilarbagpipebetweenrespondclotheshealthycarefulincludemeasuredestroysculptorvuvuzelaelephantscotlandaddition...

Los quehaceres 2024-11-25

26 Items: irondustparkmovesweepplantemptyvaccuumfix bikemake the bedfeed the dogfeed the catcut the grassset the tabledry the disheswash the disheshang up clothesclear the tableclear the tablewater the plantswater the flowersclean the bathroomcollect the garbagetake the garbage outclean the living roomclean the living room

Restaurante Word Search 2026-04-27

20 Items: playateatroparquecolmadojoyeríalibreriapanaderíaheladeríapasteleriacarniceríaA place to buy shoesA place to buy fruitA place you go to eat.a place u watch moviesa place u buy groceriesA place to eat, drink, and chilla small store usually near neighborhoodscomercial a central attraction of storesPlace that sells clothes and other personals...

Wake Word Search 2025-07-30

8 Items: to put on clothesto clean teeth or hairto move using your feetto chew and swallow foodto put things into a bagto clean something with waterto rest with your eyes closedto stop sleeping and open your eyes

Our Word Search 2025-07-04

9 Items: use who which why schoolcold told work plant placebefore every once live overmore water want because headjumped liked white giant gonebear mouse father mother friendplease after again first suddenlydifference eyes great better manythought another clothes other these

spelling 2025-07-04

9 Items: use who which why schoolcold told work plant placebefore every once live overmore water want because headjumped liked white giant gonebear mouse father mother friendplease after again first suddenlydifference eyes great better manythought another clothes other these

Rucksack Word Search 2026-01-13

15 Items: BAGBOOKLAKESHIPHOUSECARAVANCOUNTRYSIDEit is a big busyou can fly a...for example Tatryyou sleep in in on a camp sitea place with a sea and a beachyou sleep there- it's a big buildingyou need this document when you travel abroadyou put your clothes in it when you go on a trip

Our Word Search 2025-07-04

9 Items: use who which why schoolcold told work plant placebefore every once live overmore water want because headjumped liked white giant gonebear mouse father mother friendplease after again first suddenlydifference eyes great better manythought another clothes other these

Store Word Search 2023-12-12

50 Items: storecredit cardto like betterwearing apparelto look for an itemIt's not big enoughstore that sells foodformal attire for menclothing worn to swimIt's not small enoughpaper version of moneycosting a lot of moneya covering for the headsomething cost too muchsomething is too formalplace to try on clothesa specific type of sandal...

trs23 ver3 u12 2023-05-17

8 Items: Not safe.Not the same.A place to swim.Put on clothes or a hat.A contest to swim the fastest.Baseball, basketball, football etc.A kind of hat to keep your hair dry.A kind of hard hat that protects your head.

Femur-The Word Search 2025-08-28

5 Items: amphibious animala protein rich fooda layer of the tootha natural fiber from which clothes are madebaby insect that comes out of the egg of a cockroach

Alma B6U5 13ss 2025-07-04

4 Items: big paper to show somethingsomething to put on your facetell many people what you knowclothes you wear to look like something

Washer Word Search 2025-01-17

87 Items: PanPotBedMugBoxFanOvenForkSoapLampPensCoatSinkCupsBowlVentPoolDoorHatsListDryerStoveSpoonKnifeTableChairCouchPaperPlateClockPurseSprayBrushBootsShoesSocksPantsBooksPhoneWasherToiletShowerClosetPantryCoffeeMirrorOutletOfficeStairsPlantsBottleShortsShirtsJacketGarageLightsSwitchFaucetCarpetTabletOttomanSpatulaBedroomClothesOttomanPrinterPencils...

ie Wordsearch 2025-07-23

10 Items: I am potato fried.The bird ______ with wings.The _________ are like a cop.She _________ her shoe laces.The baby ___________ for food.He ________ the new ice cream.The apple _________ was sweet.You roll this in ludo to play.The clothes outside are _______?What happens when you put nuggets in hot oil?

trs23 ver3 u16 2023-06-17

10 Items: Begin.Put on clothes.Learn from books.A book for writing in.Put a jacket on a hook.A picture made with paint.We use it to write on paper.A place where we sit and learn.We use it to draw straight lines.A school subject where we learn to add numbers.

Psychologist Word Search 2025-06-16

12 Items: ProtectionEasy to get.Fun, enjoyable.Give work to someone.Works for the government.Someone who advises peopleA story told using pictures.Someone who watches an event.Shows off clothes or accessories.Helps people with their emotional problems.To give money to organize an activity or event.Learning the skills you need for a new job or activity.

LOS QUEHACERES SOPA DE LETRAS 2024-02-29

17 Items: to cookto dustto vacuumto mow the lawnto make the bedto set the tableto do the laundryto sweep the floorto wash the dishesto clean the houseto clear the tableto iron the clothesto prepare the foodto take the trash outto dust the furnitureto get something dirtyto neaten; to straighten up

Wake Word Search 2025-07-29

8 Items: to put on clothesto chew and swallow foodto put things into a bagto move by using your feetto clean your teeth or hairto rest with your eyes closedto stop sleeping and open your eyesto use water to make something clean

Pobre Ana Ch 1 Vocab 2025-09-04

31 Items: newcookfoodmeatpoorbrownapplemoneynevershirtblondshoesI wantalwaysclotheshelp meto savebeautifula attendss/he takess/he wearss/he laughsfor permissionsuelo the floorshopping centercomas don't eat!pongas Don't put!s/he asks him/hers/he tells him/hers/he gives to him/hers/he gets good grades

Find Princess Peach’s missing things 2025-02-03

7 Items: Something she wears on her headSomething she wears on her feetSomething she wears on her earsSomething she wears on her handsHer favorite pink clothes to wearSomething she uses to brush her hairSomething she uses to cover herself in the rain

Housing 2026-03-17

17 Items: CouchcottageRefrigeratorWhat you cook onFuzzy floor typeThe place you cookThe place you sleepThe place you showerWhere your clothes goanother word for studyThe person you pay rent toYou use it to see yourselfThe place you park your carGrassy area around your homeWhat you look outside throughMultiple pieces in this puzzle...

Olivia's Silent consonants Crossword! 2025-11-05

15 Items: halfdodgeassigndesignColumnAnswerKnuckleCharacterKnowledgeWhen you question someone or something."Super messy and out of control!", it’s called this!When everything is quiet and peaceful, it feels like this.When you borrow money, you have this until you pay it back.A little line or fold that shows up on clothes—or sometimes on skin as we get older!...

Fun 2025-02-25

101 Items: airportalcoholarrivalarticlechapterclothesdiseaseemotionfindingfishinghearinglibrarymessagepassionpenaltyphysicsproblemspeakerthoughttraineractivityattitudebaseballdatabasedirectorelectionelectionemployeefootballhospitalindustrylanguagemarriagepaintingproposalrelationsecuritystrategyagreementcomplaintconfusioneconomicsinsurancemarketingnewspaper...

AHHHHHHHHHHHH 2025-05-08

97 Items: cancapcarcatcrycupcutaddsAnyablahcakecallcardcarecasecitycoatcoincoldcombcomecookcoolcorncostblockcarrycatchchairchasecheapchildclasscleanclearclimbclockcloseclothcloudcolorcountcovercrashcrossadidasadipexadjustcandlechancechangecheesechoicechoosecircleclevercloudycoffeecommoncoppercornercourseadaptedadapteraddressadjustmcarefulcentralcentury...

Almostthere Word Search 2025-09-09

100 Items: BIBJOYBABYBURPCOOSCRIBLOVEMILKRASHTOYSAUNTSBOOKSCRAWLCUTIEDADDYGAMESGIFTSLABORMOMMYSOCKSSWINGWIPESBEANIEBOTTLEBUNDLECRYINGDIAPERFAMILYGERBERINFANTRATTLESHOWERSPITUPUNCLESBLANKETBOOTIESCARRIERCARSEATCLASSESCLOTHESCUDDLESDUEDATEFLOWERSFORMULAFRIENDSLULLABYMITTENSMONITORNAPTIMENEWBORNNOSLEEPNURSERYNURSINGONESIESPAJAMASPAMPERSPARENTSPUZZLESSWADDLE...

Monthly Challenge C-D 2023-03-09

102 Items: cancarcatcowcrycupcutdaddaydogdrycakecallcardcarecavecityclapcluecoatcoldcomecookcoolcopydarkdeardeepdeskdolldoordowndrawdropdrumduckcarrycatchcausechairchantcheckcheerchildclasscleanclearclimbclockclosecolorcouldcountcovercrosscrowddancedirtydreamdressdrinkdrivecameracannotcastlecenterchancechangecheesechoosechoruscirclecookiecoursecrayoncreate...

Around the House 2026-02-09

100 Items: bedcupfanmoppanpenpotrugbookbowlcoatcombdeskdoorforkhookironkeysknoblampovensinksoaptileventatticbenchbroombrushchairclockcouchdryerfloorframeglassknifelightpaperphotoplatepursesheetshelfshoessocksspoontabletoweltrashcandlecarpetclosetdrawerhangermirroroutletpantrypillowremoteshowerspongestairsteapottoiletvacuumwasherwindowbathtubbedroomblanket...

HOMOPHONES 2014-12-14

97 Items: besoarkbuyduedyeewefluforlednewwonseesumtoewaraideislebearbeatburyblewbuoyseedsellcordfarefeethairheelliarmademaleneedpailpeekpourpreywrapringrollroseseemsoresoultalewailwaitwornaloudaltareightbirthbreakbreadbuildsensesightqueuedoughflourgrownwholepeaceplanereignwritesteeltheretongswastewitchborderbrowsechoosecorpsecourseelicitgreaselessonceiling...

Around the House 2024-12-03

100 Items: bedcupfanmoppanpenpotrugbookbowlcoatcombdeskdoorforkhookironkeysknoblampovensinksoaptileventatticbenchbroombrushchairclockcouchdryerfloorframeglassknifelightpaperphotoplatepursesheetshelfshoessocksspoontabletoweltrashcandlecarpetclosetdrawerhangermirroroutletpantrypillowremoteshowerspongestairsteapottoiletvacuumwasherwindowbathtubbedroomblanket...

Fun 2025-02-24

101 Items: airportalcoholarrivalarticlechapterclothesdiseaseemotionfindingfishinghearinglibrarymessagepassionpenaltyphysicsproblemspeakerthoughttraineractivityattitudebaseballdatabasedirectorelectionelectionemployeefootballhospitalindustrylanguagemarriagepaintingproposalrelationsecuritystrategyagreementcomplaintconfusioneconomicsinsurancemarketingnewspaper...

100-Words! 2025-05-11

100 Items: IceJobFunBlueArtsKindNiceKidsColdCuteFoodCakeSodaBeerBestWaterJuiceCardsPaintGamesBraveQuietMusicCrownQueenBirthLunchPizzaPollsFunnyHouseCrocsShoesCleanTreatFlowerLovingMotherPrettyCanvasStrongPartysInsideFamilyCarverDinnerHotelsMesserCollarPeopleLasagnaHealthyLettersHusbandFriendsClassesBedroomHolidayAmazingNappingTakeoutPotatosChickenPuzzles...

Your Own 2025-06-26

100 Items: seemapjoybegsitnewmixpickskinpartjailwireslotbitesavesoultollbushlateloanpoorfreemineexitbabymindknotallytestcordpumpcoinwillbridepaniccatchofferclassloverthicksnackmercypitchsalonfaintejecttoastarisedriveforumdozentheftwagonclosegloveleashstuffshaftpoetrybishophelmetremindstressappealorangefilterexpandoriginsafariresisthappenagendatenantregard...

Household Items 2026-03-14

100 Items: bedcupfanmoppanpenpotrugbookbowlcoatcombdeskdoorforkhookironkeysknoblampovensinksoaptileventatticbenchbroombrushchairclockcouchdryerfloorframeglassknifelightpaperphotoplatepursesheetshelfshoessocksspoontabletoweltrashcandlecarpetclosetdrawerhangermirroroutletpantrypillowremoteshowerspongestairsteapottoiletvacuumwasherwindowbathtubbedroomblanket...

6th grade - Poem for My Librarian, Mrs. Long 2025-11-21

11 Items: a porch swinga condition or statea cabinet for clothesa machine that plays musica person who leads a churchthe actions of the governmentcausing shame or embarrassmentdespite what has just been saida building that has books to lendto take and use for a period of timea small device, such as a radio, that can be carried

HOUSE 2024-11-12

100 Items: bedcupfanmoppanpenpotrugbookbowlcoatcombdeskdoorforkhookironkeysknoblampovensinksoaptileventatticbenchbroombrushchairclockcouchdryerfloorframeglassknifelightpaperphotoplatepursesheetshelfshoessocksspoontabletoweltrashcandlecarpetclosetdrawerhangermirroroutletpantrypillowremoteshowerspongestairsteapottoiletvacuumwasherwindowbathtubbedroomblanket...

Vwo 1: Unit 2 2025-02-21

102 Items: ACTBUYCANDAYEATEGGFITHATTIECOATDISHDRAWHOURLAMBMAINMEALPASTPLAYREADSHOESIDESINGSIZESOCKSUITWEARYEARAPPLEBREADCLOCKDAILYDAIRYDANCEDRAMADRESSFRUITJEANSLUNCHMATCHMONTHMUSICNIGHTORDERPAINTPANTSSCARFSERVESHIRTSKIRTSPORTWRITEBAKINGBLOUSECARROTCHEESECHOOSECINEMACOOKIEGAMINGJACKETJUMPERLISTENMINUTEMOMENTMOVIESOUTFITPOTATOSHORTSTOMATOWEEKLYBISCUITCENTURY...

6th Frye List 2025-08-22

98 Items: joblaysatskysumarmsbillbluecantdropedgeeggsfeltgoneheldkeptlegslovemainmeetmindmoonpastracerainrootsignsitesofttestwallwestwidewildwishcausecellsdancedrivegrasshappyheartpaintreadyshallstorethirdtrainbesidecenterenergyEuropeforestlengthmattermonthspickedraisedreasonrecordregionreturnsimplesquaresummerwindowwinterbelievebrotherclothesdividedfarmers...

Flower Word Search 2025-12-30

100 Items: IceJobFunBlueArtsKindNiceKidsColdCuteFoodCakeSodaBeerBestWaterJuiceCardsPaintGamesBraveQuietMusicCrownQueenBirthLunchPizzaPollsFunnyHouseCrocsShoesCleanTreatFlowerLovingMotherPrettyCanvasStrongPartysInsideFamilyCarverDinnerHotelsMesserCollarPeopleLasagnaHealthyLettersHusbandFriendsClassesBedroomHolidayAmazingNappingTakeoutPotatosChickenPuzzles...

Adorable Word Search 2026-03-04

100 Items: BIBBOWBOYDUEJOYBABYBATHBURPCAKEFEEDGAMEGIFTGIRLHATSHUGSLOVEMAMAMILKNAMEPINKBLISSCARDSCHAIRCHARMCHILDCRAWLCUTIEDECORDREAMFAVORHELLOMOMMYPARTYAUNTIEBEANIEBLOCKSBOTTLEBUNDLECANDLECHEERSCOOKIECRADLECUDDLEDIAPERFAMILYGIGGLEINFANTKISSESONESIEPARENTRATTLERIBBONSHOWERARRIVALBLANKETBOTTLESBOUNCERBROTHERBUTTONSCARSEATCLOTHESDELIGHTDIAPERSFOOTIESFRIENDS...

Tumble leaf 3 2026-03-23

97 Items: CANJIGNAPWEBZENPOTEGGBIRDBOWLLEAFROSEPAILSOAPFLATSNAPBIKEREELWILDMITTBARNLOOMCANEGOLFHORNCHALKBEACHSHELLSCARESTUCKTOOLSBEADSRIVERBELLSSTACKWEIRDOFUNNELBASKETTURTLEHOGBUGRACKETPILLOWRIPPLESTRESSCOFFEEHEIGHTSHAPESMURPHYBALLETTUXEDOLEAVESQUARTZAMAZONHODGESBIXPIXPRESENTCLOTHESARUGULASKIMMERMONSTERDRAWINGANCHOURPAPERBAGPOSTCARDPINWHEELFEATHERSSNOWBALL...

Spanish Vocab 2026-04-21

47 Items: eatbutbuyworkreadparkI gotripcitycardcashstudywatchhousestorenightneverafterhotelbeachshirtpantsshoesdressmoneylistenschoolalwaysyou gobeforejacketI wantlook atmorninghe goesthey gobecauseclothesreadingpracticestudyingI preferafternoonsometimesevery dayrestaurantto reserve

... 2025-12-09

15 Items: : place to see animals: to speak words aloud: place to fly on a plane: place to keep or get money: feel happy about something: feeling pleased or thankful: place to drink coffee or tea: feeling anxious or concerned: send a message on your phone: to perform an action or task: to create or produce something: place to buy clothes or things...

The Prince and the Pauper 2024-04-18

11 Items: to not remember"King Henry is _____."a large group of peopleA ____ stole the money.The robber is in _____.unhappy because you are aloneThe title is The Prince and the _____.The prince and Tom changed their _____.a large house where a king and queen livesEdward and Tom were _____ on the same day.a person who works in a house and cooks and cleans

WI4 Unit 5 Vocabulary 2025-09-23

10 Items: 100 yearsto keep safea style of clothesgiving ease or comfortbeing or looking propersomething that is usefula brand or chain worn around the wrista special suit of clothing for a group of peoplea picture or pattern made with a needle on the skinan extra item that isn't essential but makes an outfit more fun

trs23 ie2 u5p1 2023-01-12

10 Items: a small, glass ballput it with your keysa kind of scary animala small model of a personuse it to erase your writingput it on your clothes or baguse it to sharpen your penciluse it to colour in a drawingstick it on paper or on your thingsblow it up and it will float in the air

Rich, Word Search 2023-08-24

4 Items: lionzebrahippospends, front, mirror, beautiful, clothes, must, agree, coat, lovely,fabric, clever, stupid, fool, arrive, speak, silk, gold,pretend, hard, worried, idea, minister, tries, waiting, answer, palace, visit, city, costs, fortune, terrible,pleased, people, wea

Furniture and household objects 2025-09-09

12 Items: container for flowersclock that wakes you upcloth that covers windowssmall carpet on the floorbig comfortable chair with armstall piece of furniture for bookstall cupboard for hanging clothesthick cover for a bed to keep warmglass surface where you see yourselfcover for a window that you pull downsoft thing under your head when you sleep...

Kynedi's word search 2024-02-01

10 Items: fool or cheat (someone).totally bewilder or perplex.abundant in supply or quantity.disappear suddenly and completely.take hold of suddenly and forcibly.having a sharply strong taste or smell.exclude (someone) from a society or group.easily persuaded to believe something; credulous.contrary to reason or common sense; utterly absurd or ridiculous....

Vocabulary WS Purple UNIT 11 2025-10-12

8 Items: The fox lives in a ___________.Seven is an _____________ number.The girl ________________ her arm on the wall.The test made the students feel ________________.I will ___________ an arrow from the wooden branch.We must wear the ______________ clothes on Chuseok.The boy will ________________ his bicycle around the corner....

Our (old) vocabulary words 2026-02-11

8 Items: Attention to detailDifficult to understand; obscure.Willing to take risks or embark on a journeyEnergetic, or dramatic movements with the handsA person's hair, clothes, or appearance that is untidy.Able to withstand or recover quickly from difficult conditions.Something/someone with a high reputation, respected, and admired....

The Big One 2023-04-19

108 Items: beanywayseaseeteahadsawtootwoairmrsi’museouritswereyourcamemanykeepmusttookjustgirllotseachfeetneedcomewentsomeherebabywantgonelonghe’si’lli’vegaveit’sheadknoweyeswherewe’resleepthreelooksriverthinkaboutsmallfirstothercan’tdon’ttheretheirplacegreatagainalongbegannightrightwhitefoundgoinggiantaskedlet’scriedqueenyou’redidn’tlittlethat’sacrossplease...

Ri Ehcardō Ai Sciphabeta’pom Chyinesȃ 2022-10-23

50 Items: ManEyeSunDogEatRunTreeHandSilkGoldBirdMeatFireFootFishJadeWalkLeafCartCityRiceCaveRainWineRoofGateHairLackGrassWaterMouthHeartWomenStoneHorseGrainKnifeMoundShellInsectBambooSpeechTurbanClothesLeatherMountainSicknessJade (Enlongated)Rap (as in to tap)Earth (As in dirt/stone)

Reflexive and Non-reflexive Word Search 2025-01-11

24 Items: to goto callto agreeto sleepto leaveto changeto rememberto go to bedbathe oneselfto fall asleepto see oneselfto relax someoneto change clothesto relax (oneself)to get or to becometo put others to bedto feel (emotionally)to call oneself (name)to feel (perceptually)to watch, see somethingto bathe someone or a petto brush something (teeth)...