chemical reaction Word Searches

Module 8: Week 3 Word Search 2025-06-03

1 Item: selection, tense, tension, react, reaction, confess, confession, decorate, decoration, contribute, contribution, connect, connection, admire, admiration, music, musician, electric, electrician

Volition Word Search 2025-01-06

15 Items: deeply respected or honoredshowy but cheap and of poor quality.shining with light; bright or radiantreserved or uncommunicative in speech; saying littlecheated or deceived someone to take money or property.firm and steadfast in loyalty, principles, or adherence.the power of using one's will or making a conscious choice...

Isaac 2025-08-25

193 Items: numbkeenmassarchvarycafégrimfleepeerdeaforalatomdoubtdailyglareaisleniecedoughcoughchiefanglecyclewhosetimidwrongtermsaheadchoseflingchaosalterouncelocalkneelcoastenjoyvaluemisusetonguebruisemurmurorphanheightmuscleschemerhythmpiercedecentcolumnchoosecerealcocoonaffectcasualannualcasualdeafenpluraleffectcourseoxygenexpandremedyassureagreedhorror...

Disease, Illegal Drugs, Medicine 2025-12-09

30 Items: Not allowed by lawChemical substancesScarring of the liverDrugs prohibited by lawSingle-celled organismsTaking too much of a drugThe consumption of a drugTiny germ that reproducesA dependence on a substanceProtection against a diseaseA strong feeling of happinessYellowing of the skin and eyesA mental state of extreme fear,...

Care of the HIV patient 2024-02-14

16 Items: toxica type of white blood celltransmission from a mother to a fetusa cell that ingests and digests bacteriaa virus that uses RNA as its genomic materiala virus that attacks the body's immune systemthe loss of lean body mass as a result of illnessan early biomarker of the cellular immune response...

Residentflora Word Search 2025-10-17

11 Items: usual steps to prevent injury or diseaseinvasion by disease-producing microorganismsChemical that kills most pathogenic microorganisms; disinfectantact or process of rendering an individual immune to specific diseasemicroorganisms normally found in the body; also known as normal flora...

Solutions 2023-11-16

11 Items: Heat, stir or crush solute. (solid)A data based curve that is going to inform youThe inability of the solute to form such a solution.A substance that can be dissolved into a solution by a solvent.Water is capable of dissolving more substances than any other liquid.A bond between two or more nonmetal atoms that have different charges....

Unit 1 Test Review 2023-10-24

21 Items: one way we use our foodused to handle hot potsphysiological influence examplethe body's main source of energythis is used to reach high placestype of shoes worn in the kitchenthis provides our body with energyshould be disposed of with a broomcarries nutrients throughout the bodythis is an example of a media influence...

8th Grade Science Word Search 2023-05-17

23 Items: heat energyform of energy in the sunused in night vision gogglesenergy of an object in motionatom or compound with a chargesubatomic particle with no chargeused for cell phone communicationform of energy in food and batteriesform of energy resulting from motionpositively charged subatomic particlenegatively charged subatomic particle...

Plastic: Here to stay? 2022-10-10

9 Items: capable of being made newA place where trash is buried or placed on top of the groundTo make something new from something that has been used beforepolymers that are produced by or derived from living organismsnot capable of being broken down by the action of living organisms...

Our Environment 2023-10-10

15 Items: Bodies of flowing water.Channeling waste into open sea.An overflowing of water onto land.The land near a shore where water and land meet.The method of providing water to dry land for farming.The action of making an environment impure or unclean.Forest with tall trees that are found in places near equator....

Vocab 3 2024-09-18

15 Items: A living part of an ecosystemA nonliving part of an ecosystemStep in a food chain or food webAn organism that makes its own foodAn organism that cannot make its own foodA consumer that eats both plants and animalsConversion of light energy from the sun into chemical energyOrganism that feeds on plant and animal remains and other dead matter...

Chapter 21- Health and the Environment 2025-05-14

16 Items: A living thing’s surroundingsis protecting and using resources wiselyis a material that can be used to meet a needis a chemical used to kill pests, such as insectsis a chemical used to kill pests, such as insectsis a group of organisms living in an area at one timeoversees safety and health in workplaces (abbreviation)...

ENERGY WORD SEARCH 2025-11-10

1 Item: SOLAR ENERGY NUCLEAR WATER RENEWABLE KINETIC POTENTIAL HYDRO CHEMICAL RADIATION DAM TURBINE HYDROELECTRIC TRANSFORMATION ELECTRICAL THERMAL WIND

Battery, Word Search 2025-11-10

1 Item: SOLAR, ENERGY, NUCLEAR, WATER, RENEWABLE, KINETIC, POTENTIAL, HYDRO, CHEMICAL, RADIATION, DAM, TURBINE, HYDROELECTRIC, TRANSFORMATION, ELECTRICAL, THERMAL, WIND,

ENERGY WORD SEARCH 2025-11-10

1 Item: SOLAR ENERGY NUCLEAR WATER RENEWABLE KINETIC POTENTIAL HYDRO CHEMICAL RADIATION DAM TURBINE HYDROELECTRIC TRANSFORMATION ELECTRICAL THERMAL WIND

Geoscience Processes 2025-06-11

8 Items: soil and rock, are worn awaygiant waves caused by earthquakes or volcanic eruptions under the seasudden ground shaking caused by movement along faults in the Earth's crusta natural phenomenon or a series of events that occur within the Earth's systems...

Pathophysiology 2025-02-17

15 Items: Infections caused by fungi.)A common bacterial skin infection.)Infections Skin infections caused by fungi)Precancerous skin growths caused by sun damage.Dermatitis A skin rash caused by contact with a specific substance.)Also known as boils; pus-filled, painful lumps that form under the skin.)...

Cycle 1 S2 Week 3 2025-01-29

10 Items: classified as chemical or physicalA shortened restatement of a text or passageA list of numbers or objects in a special ordera measure of the force applied over a unit area.a word used to describe an action, state, or occurrenceThe unlawful, random use of force or violence against persons or their property...

Engineers A to Z 2023-01-24

26 Items: Investigate force and motion by working in teams to complete design challenges and build ramps and pathways!Introduction. Genetic engineers alter, splice, eliminate, and rearrange genes in order to modify an organism or groups of organisms....

Voca 6000 Lesson 5&6 Review 2025-09-12

18 Items: to direct or control (v)to fill something again (v)high public value or respect (n)to put off until a later time (v)without any question or doubt (adv)one step in the movement of walking (n)able to happen, exist, or to be done (adj)relating to people who do not have jobs (adj)to bring back from memory; remember; recall (v)...

Dillon Singleton Ch.16 Vocab 2025-04-16

14 Items: Horizontal row in the periodic table.Vertical column in the periodic table.Number of protons in an atom's nucleus.Particle in the nucleus with an electric charge of 1+.Particle of matter that makes up protons and neutrons.Atom of an element that has specific number of neutrons.Electrically neutral particle inside the nucleus of an atom....

Nervous System 2023-02-05

14 Items: action under our controlThe largest part of the brainregulates blood pressure and breathingconnects your brain to your spinal cordextends downward from the base of your brain.voluntary control of body movements via skeletal musclesbest known for its role in responding to dangerous or stressful situations...

Neuron Word Search 2025-09-17

14 Items: Basic nerve cell that transmits electrical and chemical signals.A neurotransmitter linked to reward, motivation, and movement control.Fatty insulating sheath around some axons that speeds neural conduction.— A neurotransmitter involved in muscle activation, attention, and memory....

Estates Word Search 2023-11-24

18 Items: 1793, January 21: Execution of _____.1793, October 16: Execution of Marie _____.1789, August 4: _____ abolished in France.1789, May 5: _____-General convened in Versailles.1795: Establishment of the _____, a five-member committee.1799-1804: The Consulate period, with _____ as First Consul....

First Aid 2025-04-17

54 Items: beneath the top layer of skinHeavy, uncontrollable bleedingA wound that is torn and raggedNot serious; on the surface;shallowDamp,soft,sticky, and unusually coolarrest The sudden stoppage of the heartA snug bandage used to control bleedingAn anti toxin used to counter act venomOintment and bandages applied to a wound...

Yorkie’s Wordsearch # 1 2023-12-18

42 Items: Water? (4)Cetacean (5)Loiterer (7,5)Steak type (5)I'm extinct (4)Who the ….? (5)Drunk again? (7)Hazel rodent (8)Chocolate bar (6)Aquatic horse (5)Whipping boy (3,5)Chimp perhaps? (6)Pets or spoons (7)Not this way! (2,5)A pan coating (3,5)Urticaria cause? (7)A bit of a pansy (5)Depressed equine (6)French instrument (4)European footwear (5)...

7th Grade Final Review 2025-12-16

34 Items: stored energyball on a hillenergy in motionall living thingsstored in nucleusall water on earthcauses earthquakesability to do workheating of objectsspring or rubber bandcurrents in a circuitwaves, voice, speakercauses seafloor spreadingpush or pull of an objectcar, skateboard, airplaneheat transfer through wavesfossil fuels, food, battery...

Let's See What You Know ;) 2024-11-27

17 Items: Uncontrolled cell growthThe body's basic fuel supplyEssential for healthy bones and teethPeople who only eat food from plant sourcesCauses bones to become weaker and break easilyNutrients people take in addition to the foods they eatPeople who eat eggs in addition to foods from plant sources...

Elements Word Search 2024-01-17

19 Items: one cycle per minuteouter ring of electronssmallest units of an elementthe steps necessary in a processpositively charged elementary particleselementary particles with no electrical chargethe flow of electrons from atom to atom in a conductorthe movement of electrons being directed through materials...

Decision Making 2025-02-21

11 Items: to stop developing, growing, progressing or advancingcombination of surroundings, conditions or influencesa thing which is regarded as more important than othersstrategy in which a person goes with their first reactionstrategy in which a person hands over control or lets someone else decide...

6th Grade Final Review 2025-12-12

33 Items: stored energyball on a hillenergy in motionhow energy movesall living thingsstored in nucleusall water on earthcauses earthquakesheating of objectsability to do workspring or rubberbandcurrents in a circuitwaves, voice, speakercar, skateboard, walkingcauses seafloor spreadingpush or pull of an objectprocess of changing position...

Pathophysiology - Ch. 15 + 16 Terms 2024-11-05

20 Items: Double visionBlood glucose levels riseParalysis of the upper eyelidA ringing or buzzing in the earsExcessive thirst caused by dehydrationExcessive amounts of ketones in the bloodActivated by a change in chemical concentrationInvoluntary, abnormal rapid movement of one or both eyesStimulates appetite; lack of nutrients entering the cells...

Histology Word Search 2025-10-02

22 Items: inflammation of a glandproduces hormones; no ductsSurgical removal of a glandmicroscopic study of tissuesAbnormal hardening of a glandAny disease or condition of a glandSecretes chemical substances into ductsincrease in bulk of body part/organ due toMalignant tumor originating in glandular tissuecontains cells specialized to contract and relax...

Infection control 2025-10-27

30 Items: A microorganism capable of causing disease.Separating patients to prevent the spread of infection.Completely free of all microorganisms, including spores.A biological substance that poses a threat to human health.A chemical used on non-living surfaces to destroy pathogens.living organism (like a mosquito) that transmits infectious disease....

Chemistry, Physics, and Energy 2023-05-14

20 Items: measured in Newtonsmeasured in mL or cm^3they make up the periodic tablemetals are good examples of thesethe first step in the water cyclethe formula for it is mass/volumeplastics are good examples of thesethe formula for it is distance/timea phase change, the opposite of depositionthere are two types of it-positive and negative...

6th Grade Final Review 2025-12-12

33 Items: stored energyball on a hillenergy in motionhow energy movesall living thingsstored in nucleusall water on earthcauses earthquakesheating of objectsability to do workspring or rubberbandcurrents in a circuitwaves, voice, speakercar, skateboard, walkingcauses seafloor spreadingpush or pull of an objectprocess of changing position...

Pool Safety Word Search 2025-06-04

15 Items: Always read this before using any pool product. (5 letters)Important to have when handling chemicals indoors. (11 letters)What you use to keep the pool water clean and safe. (8 letters)A common disinfectant, dangerous if mixed with acid. (8 letters)A cool, dry place where pool products should be kept. (7 letters)...

QUIZ 2025-11-28

15 Items: Who pioneered the technique of PCR?Who is known as the Father of Genetic Engineering?What type of tertiary structural protein is Keratin?Which is the least abundant Granulocyte in our body?Which family of organism does Dengue virus belongs to?Gout's disease is caused due to higher accumulation of?...

ENGINEERING + 2024-08-20

1 Item: AERONAUTICAL BIOMEDICAL SOFTWARE COMPUTER MECHANICAL ELECTRICAL CHEMICAL SAFETY DANGER FALL LOUD FIRE MEDICAL FORKLIFT GLOVES EYEWEAR HEARING BREATHING RADIATION RESPIRATOR EMERGENCY

Chem-is-tree Holiday Word Search 2024-12-18

14 Items: Major flavor component of clovesMajor flavor component of cinnamonThe alkaloid compound found in mistletoeThis compound gives ginger its pungent odorThe chemical in peppermint that makes your mouth feel coldType of compounds that give poinsettia leaves their red colorThis Group 13 Period 4 metal is frequently found in LED lights...

Melting, Word Search 2024-05-13

1 Item: FAMILY, COMPOUND, PROTON, PHYSICAL CHANGE, GAS, MATTER, CHEMICAL CHANGE, FREEZING, NEUTRONS, MOLECULES, ELEMENT, SOLID, PRODUCT, ATOMS, GROUPS, NUCLEUS, METALS, PLASMA, PERIODS, LIQUID

Persuasive Devices Word Search 2023-07-27

18 Items: “All teenagers are lazy and rude!”“We met in 1999 when I was at University”Gets an emotional reaction from the reader“The Prime Minister is a total raving idiot”“All famous people live rich and exciting lives”“A teenager swore at me on the train. How lovely!”Suggests the reader must always support their country...

Rhetorically 2023-11-09

15 Items: The author’s attitude when writingRepetition of a beginning phrase (“I have… I have… I have…”)Using highly detailed language that appeals to the five sensesOffering specific details or instances as a way to support a claimGiving compliments to someone in order to win their good favor/affection...

1.02 2025-05-13

37 Items: Refers to fabric right off the loom.used on polyester and acetate fibers.Compounds that penetrate and color fibers.Combines both roller and screen printing methods.applied to the fabric make them inedible to moths.Ink jet based method of printing colorants onto fabric.Resistance resists the growth of mildew and other molds...

Week 3 Review by Sharli Syed 2023-09-25

17 Items: What a substance is when it has a pH of 7._______ compounds are compounds that contain carbon.Simple sugars; links together to form carbohydrates.Breaks down monomers, separating them by "adding water."Substances that have an excess of H+ ions; pH less than 7.Measure used to express how basic or acidic a substance is....

1. Word Search 2025-03-17

1 Item: Chemical Characteristics 2. Cladogram 3. Dichotomous key 4. domain 5. Genus 6. Kingdom 7. Physical Characteristics 8. phylum 9. species 10. taxonomy

Muscles 2024-09-19

14 Items: The starting point of the muscleWhere the muscle inserts on the boneThick fleshy central part of the muscleJunction between the nerve fibre and the muscleConnective tissue sac filled with synovial fluidChemical that transmits the impulse across the gapWhen a muscle is used or exercised and becomes bigger...

WBGT and Heat Illness Prevention 2025-05-01

25 Items: a recommended strategy to avoid heat illness.the key recommendation when WBGT is moderate.The NATA statement on exertional heat illness.this term is associated with heat from the sun.an action needed when WBGT reaches Extreme Risk.component measured by a thermometer in the shade.The heat stress level that can lead to heat stroke....

Force and Motion 2023-11-27

20 Items: Unit of ForceA push or pullDistance over timeThe amount of matter in an objectDistance over time with a directionAn object's resistance to change in motionthe measurement of paths taken by an objectthe action or process of moving or being movedSpeeding up, slowing down, or changing direction...

Aaaa 2025-12-01

40 Items: - first step of respiration-A molecule that helps form acetyl-An organism that can create its own food-Respiration that uses oxygen to make atp-Organisms that must have oxygen to survive-part of the light reaction that makes nadph-the energy molecule cells have which do work-Organisms that don’t quite need oxygen to live...

Griffith Observatory Glossary 2023-11-14

20 Items: a fluid state of matterthe study of space & everything in itthe layer of gas that surrounds Earththe 6th element & chemical basis for lifea place for observing & studying objects in spacea pure substance containing only one type of atoma celestial body of gas that generates light & heata zone around a star where temperatures are just right...

Treaty of Versailles Ceviche Style 2025-09-04

21 Items: German airships used for bombing raids.Prevented supplies from reaching Germany.Peace treaty ending WWI; punished Germany.Union between Germany and Austria forbidden.Used by Germany to sink Allied supply ships.German emperor who abdicated in November 1918.(Nov. 11, 1918)Agreement to stop fighting WWI.Payments Germany owed to Allies for war damage....

May 2025 Wordsearch 2025-05-02

20 Items: the ability of an organism to resist diseasetreatment intended to relieve or heal a disorderthe invasion of the body by harmful microorganismsthe process of returning to a normal state of healththe identification of the nature of an illness or problemthe action of stopping something from happening or arising...

Bio 10 Lesson 2.1/2.2 Vocabulary Word Search 2025-10-05

23 Items: Center of an atomThe basic unit of matterBond that opposites attractBond that shares of electronsScale that values from 0 to 14Dissolving substance in a solutionNegatively charged subatomic particleSubstance that is dissolved in a solutionAtom that has a positive or negative chargeMixture of water and non-dissolved material...

hi 2024-05-17

14 Items: the circular motion of an object around its centerthe amount of space occupied by a sample of matterThe SI derived unit used to measure energy or work.a positively charged region at the center of the atoma chemical element with symbol Ag and atomic number 47.a force which tries to pull two objects toward each other...

4TH QUARTER SCIENCE VOCABULARY WORD SEARCH 2024-04-03

1 Item: SOIL, IGNEOUS, SEDIMENTARY, METAMORPHIC, WEATHERING, MECHANICAL, CHEMICAL, EROSION, QUARRYING, MINING, LANDSLIDES, WEATHER, CYCLONE, DEPRESSION, STORM, TYPHOON, MOON, PHASES, CRESCENT, GIBBOUS, WAXING, WANING, STARS, CONSTELLATIONS

Science: Word Search 2024-08-18

19 Items: Living planetThe study of lifesignal to which an organism respondsthe variable that is deliberately changed.A single organism produces offspring identical to itself.all other variables should be kept unchanged, or controlled.logical interpretation based on what scientists already know....

ch 4 vocab 2025-02-26

15 Items: Rate at which energy is converted.Energy that is due to chemical bonds.Machine that does work with only one movement.The ability to cause change, measured in joules.Energy a moving object has because of its motion.States that energy cannot be created or destroyed.Transfer of energy when a force is applied over a distance....

Chapter 15 - Key Terms 2023-11-01

10 Items: Mucous membranes of the eyes.A process of cleansing to remove undesirable debris.Complete destruction of organisms after they leave the body.The complete destruction of organisms before they enter the body.Date after which a product is no longer effective and should not be used....

GENETIC AND ENVIRONMENTAL IMPACTS ON GROWTH 2025-10-04

15 Items: HOW GENETIC TRAITS ARE "SEEN"DIET, EXERCISE, STRESS, AND EXPOSURE TO TOXINSINCREASE OF RISK POSED BY A GENETIC PREDISPOSITIONREDUCTION OF RISK POSED BY A GENETIC PREDISPOSITIONCERTAIN CHEMICALS CHANGE THE CHEMICAL BEHAVIOR OF DNA _____THE PASSING DOWN OF CHROMOSOMES AND GENES FROM ONE GENERATION TO THE NEXT...

Health 2025-10-27

17 Items: A disease that destroys alveoliAn addictive drug found in tobaccoAir that has been contaminated by tobacco smokeA thick,dark liquid that forms when tobacco burnThe smoke that a smoker inhales and then exhalesThe blue in the throat that takes air to and from the lungsA colorless,odorless,poisonous gas produced when tobacco burns...

World War 1 2025-03-20

12 Items: An explosive used to destroy submarines.Monetary payment is used to right a wrong.Naval submarines used by Germany in World War 1.A position of remaining neutral in times of conflict.African-American Regiment that fought on the front lines of World War I with the French....

Human-Environment Settlement 2023-05-04

32 Items: to give support toremoval of all treesarea turns to a deserteffort to restore forestsraising of animals for foodelectricity powered by waterremoval of salt from seawaterwide variety of life on Earthhaze caused by chemical fumesresource that can't be replacedpermanently frozen layer of soilrich soil made up of sand and mud...

lab safety 2025-12-15

1 Item: goggles, lab coats, accidents, hazards, sink, eyewash stations, fire extinguisher, chemical storage, fire safety, No horseplay, label containers, professional behavior, walk always, no food, no drinks

Heat Word Search 2025-04-10

1 Item: waves, chemical waste, climate change, rising sea levels, deforestation, plastic debris, extinction, endangered species, smog, fossil fuels, renewable energy, carbon footprint, greenhouse gases, environmental pollution, recycling.

5. Cells & Energy 2022-11-02

22 Items: without oxygenSugar (C6H12O6)requires oxygenBasic unit of lifethe outer covering of a cell or organelleget their energy from the sun, example plantsplace in a eukaryotic cell where the DNA is locatedtiny structure that performs a specific job in a celladenosine triphosphate, a molecule that stores energy...

Year 7 so far! 2023-05-26

28 Items: Organelle that contains DNA (n)The smallest unit of matter (a)The force caused by gravity (w)Multiple atoms bonded together (m)Different atoms bonded together (c)Used to separate soluble solids (c)Change of state from solid to gas (s)Type of energy linked to movement (k)The unit of measurement for force (n)Change of state from gas to liquid (c)...

Sewer Word Search 2025-07-15

35 Items: Wet, soft earth.Dead body of an animal.Discarded items, refuse.Oily or fatty substance.Thick, gooey mud or waste.Internal organs, entrails.Black dirt, soot, or filth.Repulsive dirt or pollution.Deep excavation for minerals.Unwanted or unusable material.Slippery black liquid, often crude.Black, sticky road paving material....

S2 Science word search 2025-05-22

20 Items: A living thing. (O, 8 letters)The smallest unit of matter.(A, 4 letters)The flow of electric charge. (C, 7 letters)A group of atoms bonded together.(M, 8 letters)A push or pull acting on an object. (F, 5 letters)The ability to do work or cause change. (E, 6 letters)A pure substance made of only one type of atom.(E, 7 letters)...

Unit 05 Health and safety in the uniformed services 2025-12-11

1 Item: Hazard Accident Safety PPE Fire Firstaid Emergency Legislation Compliance Training Reporting Supervisor Employee, Employer Manualhandling Infection Decontamination Evacuation Protectiveclothing Uniform Boots Gloves Helmet Hygiene Chemical Policy Procedu

Sanremo artists 2024-05-21

108 Items: ldabugoemmagaiaModàollyrikiwillarisaclaraelisafasmafedezghaliiramalazzanoemirkomisethusharitoscayumanarieteblancoelodieghemonIl TreLa SadmadamemorganrandomultimobigmamadiodatogeoliergiorgiaIl VololevantemahmoodmaninnirancoretananaiAnna OxaannalisagazzelleGio EvanMåneskinMr. RainColla ZioComa_CosegianmariaMax GazzènegramaroRenga NekErmal Meta...

Mike Rowe's Dirty Jobs 2025-07-15

35 Items: Wet, soft earth.Dead body of an animal.Discarded items, refuse.Oily or fatty substance.Thick, gooey mud or waste.Internal organs, entrails.Black dirt, soot, or filth.Repulsive dirt or pollution.Deep excavation for minerals.Unwanted or unusable material.Slippery black liquid, often crude.Black, sticky road paving material....

Mike Rowe's Dirty Jobs 2025-07-15

35 Items: Wet, soft earth.Dead body of an animal.Discarded items, refuse.Oily or fatty substance.Thick, gooey mud or waste.Internal organs, entrails.Black dirt, soot, or filth.Repulsive dirt or pollution.Deep excavation for minerals.Unwanted or unusable material.Slippery black liquid, often crude.Black, sticky road paving material....

GEOLOGIC PROCESSES 2024-08-25

1 Item: Exogenous Weathering Erosion Sedimentation Deposition Endogenous Process Chemical Physical Disintegration Rock Temperature Pressure Decomposition Compound Mineral Soil Atmospheric Oxidation Substance Oxygen Hydrolysis Water Acidification Organism Earth Gr

Grade 3 Speaking Test 2023-05-25

1 Item: Albert, physical, chemical, changes, rollercoaster, quickly, slowly, solid, liquid, gas, exciting, enjoyable, summer, winter, float, electricity, annoying, sound, Science, students, teachers, English, Sinolink, Canada, South, Africa, China, experiment, sp

Pathophysiology word search 2025-02-10

15 Items: The result of an invasion by a miteThick and leathery patches on the skinAn inherited tendency toward allergic conditionsassociated with allergic responses and causes itchiness of the skinCommon infection in infants and children but can also infect adultsBenign lesions that are usually associated with aging or skin damage...

Grade 3 Speaking Test 2023-05-25

1 Item: Albert, physical, chemical, changes, rollercoaster, quickly, slowly, solid, liquid, gas, exciting, enjoyable, summer, winter, float, electricity, annoying, sound, Science, students, teachers, English, Sinolink, Canada, South, Africa, China, experiment, sp

Safety and Sanitation 2023-01-23

22 Items: Maximum safe level in foodSpoilage due to breakdown of fats.Monoxide- Odorless highly poisonous gas.Prevention of illness through cleanliness.Immediate removal of a product from store shelves.Plug- Plug that has one blade wider than the otherBurn- Moisture loss caused by improper chilling out packaging...

Final Exam Review 2023-06-02

34 Items: SI for timeSI for distanceSI unit of forceEnergy of motion.SI unit for energy.Speed plus directionThe change of velocityThe ability to do work.Characteristic or qualityEnergy that will run out.Change of position in timeMercury, Venus, Earth, MarsEnergy of position or stored.Example of a renewable energyJupiter, Saturn, Uranus, Neptune...

MATMAL 25th Anniversary Celebration! 2025-05-29

30 Items: A legendary Malay warrior.Cranio-maxillofacial surgery.The national fruit of Malaysia.The national animal of Malaysia.The empirical formula of glucose.The Empirical formula of Vitamin C.The chemical formula of tin(IV) oxide.The year which Materialise was founded.Malaysian national infused coconut dish.A famous mummy that Materialise printed....

jan edition word search 2025-12-14

20 Items: The planet 55 Cancri is made up of…First asian to receive a nobel prize in physicsThe process through which your brain eats itselfFounder of the Indian Space Research OrganisationTiny particles of pollutants suspended in the airAn amphibian that vomits out its stomach and cleans itThe brains of this creature holds the key to smarter AI...

Firstaid Word Search 2025-09-02

25 Items: Burns caused by heat exposurePain reliever and fever reducerBurn which damages the epidermisVaccine given to prevent tetanusAutomated external defibrillatorsBurns caused by friction on the skinInitial care given for an illness or injuryWhen a poisonous substance contacts the skinWhen a poisonous substance contacts the eyes...

First Aid Basics 2025-09-02

25 Items: Burns caused by heat exposurePain reliever and fever reducerBurn which damages the epidermisVaccine given to prevent tetanusAutomated external defibrillatorsBurns caused by friction on the skinInitial care given for an illness or injuryWhen a poisonous substance contacts the skinWhen a poisonous substance contacts the eyes...

Chapter One Vocab 2025-10-17

20 Items: diseasemicroorganismsmicroscopic living organismscapable of growing and livingsubstance that kills or destroys bacteriaasepsis removal or destruction of microorganismsmicroorganism that requires oxygen to live and reproducehighly pathogenic and disease-producing; describes a microorganism...

Unit 8 APES review 2024-04-30

20 Items: Where over 50% of MSW ends upA common exposure route through the airA common exposure route through the skinA common exposure route through food/ waterIncrease in death rate occurs over a large areaType of waste that is mostly chemical and constructionType of disease not caused by pathogens and can be genetic...

Cells 2025-09-25

23 Items: Organisms with a nucleus.Organisms without a nucleus.Image taken through a microscope.Double membrane that surrounds the nucleus.Organelles that digest and recycle cellular waste.DNA and proteins inside the nucleus in a loose form.Small sacs that transport materials within the cell.Proteins that speed up chemical reactions in the cell....

Naturalworld Word Search 2023-06-02

34 Items: SI for timeSI for distanceSI unit of forceEnergy of motion.SI unit for energy.Speed plus directionThe change of velocityThe ability to do work.Characteristic or qualityEnergy that will run out.Change of position in timeMercury, Venus, Earth, MarsEnergy of position or stored.Example of a renewable energyJupiter, Saturn, Uranus, Neptune...

MATMAL 25th Anniversary Celebration! 2025-05-27

30 Items: A legendary Malay warrior.Cranio-maxillofacial surgery.The national flag of Malaysia.The national fruit of Malaysia.The national flower of Malaysia.The national anthem of Malaysia.The national animal of Malaysia.The empirical formula of glucose.The national monument of Malaysia.The Empirical formula of Vitamin C....

Dillon Singleton Ch.15 Vocab 2025-03-18

15 Items: substance with atoms that are all alikechange of one substance into a new substanceheterogeneous mixture whose particles never settlesubstance in which its different components are easily distinguishedtendency for a beam of light to scatter as it passes through a colloid...

Esthetician Vocabulary 102.02 2023-01-18

22 Items: safety data sheetHazzard communication standardenvironmental protection agencySodium Hypochlorite 5.25% ConcentrateDispose of items that can no longer be usedMethicillin-resistant Staphylococcus aureusUsually able to disinfect within 10 minutesoccupational health and safety administrationmaterial that allows liquid or air to pass through...

ch 15 vocab 2025-03-18

15 Items: substance with atoms that are all alike.change of one substance into a new substance.heterogeneous mixture whose particles never settle.substance in which its different components are easily distinguished.tendency for a beam of light to scatter as it passes through a colloid....

Stage 3 A -->F 2025-04-22

31 Items: to pull towardsa very light metalwhat a place is likea young butterfly or mothan animal soon after birthsoak up or take on a liquidstopped from passing throughorganising things into groupsone intake of air by the lungsone push of blood from your heartanimals which eat other living thingswhat your body needs to make you move...

Stage 3 A -->F 2025-04-22

31 Items: to pull towardsa very light metalwhat a place is likea young butterfly or mothan animal soon after birthsoak up or take on a liquidstopped from passing throughorganising things into groupsone intake of air by the lungsone push of blood from your heartanimals which eat other living thingswhat your body needs to make you move...

Vocab 9 Practice 2025-05-12

30 Items: Not allowed by law.Not logical or reasonable.The state of being a father.The belief in more than one god.A person who helps others learn.A tool used to see very tiny things.Medium in size; not too big or small.Related to a mother or like a mother.Having more power, force, or ability.The study of a person’s family history....

Fundamentals of Biology 2025-07-28

28 Items: The smallest unit of lifeThe smallest unit of matterThe building block of proteinsA building block of DNA and RNATwo or more atoms joined togetherA group of cells that work together.A package of DNA found in the nucleusA copy of DNA that helps make proteinsThe part of the cell that makes proteinsA substance made of two or more elements...

cell terms 2025-11-24

28 Items: more than one cellcell with a nucleuspreforms photosynthesissimple cell, no nucleus“the powerhouse” of a cellconsisting of one single cellbasic unit of all living thingshooke discovered the first cellgreen pigment implants used to make food“the brain” of a cell, the control centerprocess used to convert light into energy...

How Your Body Works Wordsearch 2025-06-25

14 Items: – The muscle that pumps blood around your body. (H, 5 letters)– A blood vessel that carries blood back to the heart. (V, 4 letters)– The process your body uses to turn food into energy. (R, 11 letters)– A blood vessel that carries blood away from the heart. (A, 6 letters)– A tube that carries air from the windpipe into the lungs (B, 8 letters)...

UNIT 4 VOCAB 2023-10-06

26 Items: A period of time.A long span of time.A specific area in time.A place for storage of fluids.Earliest era in earths history.Remains of a prehistoric animal.A break in the continuous rock record.Numeric age of a layer of rocks or fossilsRecord of rock layers over a period of time.Living organism that shapes its environment....

Twenty One Pilots MOSTLY songs clues 2025-02-12

41 Items: to floata red gemto go backto get darkera tight necklaceto decorate againthe day after Fridaya door that is a trapthe place you were bornwhat a forest is made ofto sink in water quicklyyou watch TV shows on thisa compromise between peoplea really really bad headachemany tiny peices of somethinga bunch of trees in one place...