chemical reaction Word Searches

Skin Disorders and Diseases: Inflammation and Infection 2025-02-26

90 Items: LiceSitzStyeEdemaLaserLymphTineaViralAsthmaAureusEczemaHerpesImmuneOcularStressSulfurUlcersAllergyBullousFatigueIllnessPilarisPinkeyePruriusRosaceaScabiesSimplexSteroidSurgeryAbrasionAxillaryBlistersChemicalDiabetesErythemaGeneticsHormonalImpetigoNaproxenPerioralPeroxidePyogenesRetinoidRingwormVascularAcyclovirAntiviralBacterialFilaggrinIbuprofen...

Aerospace Word Search 2022-09-22

77 Items: ivappdnacellraysscanmarsmoonnasarisktoolstormfieldfocusforcegaugeliverlunarfieldmetalmodelmotororganvesselattackimpairinducekidneymarkermusclePlanetrodentsystemtissuevacuumaspirinbladderchronicculturegravitymercurysymptomtropicsvitaminweatherchemicalconstantdiagnoseengineerinternetmutationparticlepressuresoftwareaerospaceastronautbiologistcolleague...

Science 2025-01-16

89 Items: labatomcelldatafactlawsmassdatumflaskphasescaleweighbeakerbotanyenergyfossilfunnelmattermotionretorttheorytissuevolumebiologyburetteclimatecontrolcuvetteelementgeologygravitymeasuremineralobservephysicspipettescienceweatherzoologychemicalgeneticsmoleculeorganismparticleresearchtesttubevariableastronomychemistryevolutionglasswaremagnetismPetridish...

ED Word Search 2024-07-23

100 Items: cnaxrayadmitbloodstemihokascovidgownsdraincoughowaladeconchargesepsissuturetriagedivertlacticsplintscrubsurinalativanvitalspannusfunduskronoszofrantraumagreetericentrasyncopewetpreptoradolambubagsurgerystanleyallergypharmacydementiareactionwalkbackchartingdowntimetroponinculturesmonstersjaundicecriticalbloodgasswellingcodebluetransferbedalarm...

Yr9 Science Revision 2025-05-23

101 Items: FluGascanWebIonSunBondAreaMassApexAtomMoonStarCOVIDSolidSpeedFinalGraphForceChainGroupIonicMetalGiantCometOrbitLiquidEnergyMetresVolumeCarbonProtonPeriodAlkaliChargeSimplePlanetCholeraVibrateMeltingBoilingElementMixtureSecondsAverageInitialDensityBalanceSpeciesHabitatTrophicPrimaryIsotopeNeutronHalogenSharingDiamondGravityMovementFreezingCompound...

Cell Biology Key Words 2025-10-01

12 Items: The basic building block and functional unit of all known living organisms. (C, 4 letters)The control center of a eukaryotic cell; it contains the cell's genetic material (DNA). (N, 7)The specific region on an enzyme where a substrate molecule binds and where the chemical reaction is catalyzed. (A.S., 6,4)...

Concepts of Chemistry, Physics, and Energy 2023-05-24

27 Items: a dissolved substance.SOLUTEthe basic unit of a chemical element.ATOMenergy in the form of heat.THERMAL ENERGYable to dissolve other substances.SOLVENTenergy associated with motion.KINETIC ENERGYthe degree of compactness of a substance.DENSITYthe speed of something in a given direction.VELOCITY...

ADAP Chapter 3 Word Search 2025-12-17

15 Items: commonly called Ecstasy or Mollycommonly called Meth or Crystal Meththe most commonly used substance after alcoholleading cause of preventable deaths in the United Statesconsuming alcohol prior to the minimum legal drinking age of 21widely available, free or inexpensive, and falsely believed to be safer than illicit drugs...

Module 1C Processes in Plants and Animals (Regulation of Fluids, Chemical and Nervous Control) 2025-03-17

15 Items: axonponsurineAuxinskidneyneuronureterestrogenendocrinecytokininsepinephrineGibberellinschemotropismtestosteronephytohormones

Europe/ Eurasian Geography 2025-11-13

10 Items: TaxesEnemies entering by force.An old decayed plant materialMeaning little or no rainfallSupporting or advertising somethingDefined territory with its own governmentA forest area that provides valuable resourcesA chemical that kill harmful insects and weedsA country in the Eastern Europe and North Asia....

CHEMISTERY 2023-05-28

10 Items: Collect and analyze evidence from a crime scene.Are responsible for researching marine ecosystems.Study and analyze both natural and manmade items to learn more.Responsible for examining and monitoring the presence of chemicals in water.Study the appearance, movement, and effect of chemical compounds on the earth....

Healthy Weight Word Search 2025-02-05

10 Items: Extreme eating behaviorsA physical or mental tensionAn intense fear of gaining weightAbnormal response to certain foodsNegative physical reaction to foodTaking place over a long period of timeA disorder that weakens the immune systemPurging then ridding the body of the foodThe body cannot control blood sugar levels...

Science Review Word Search 2023-03-02

17 Items: F=MxAspeeding upslowing downa push or a pullfirst lunar phasethe unit for forcethe unit for energythe amount of speedthe earth orbits the...the power house of the cellwhat you can use to see cellswhat holds the slide in placethe direction the earth orbitshow many lunar phases are therethe color of the moon during a lunar eclipse...

Viva Connect - Doctor and Health Word Search 2025-05-02

47 Items: GPFluLegArmHipSickSnotBackKneeHeadToesFeetSkinRestRestTestMaskPainNeckCoughFeverHeartAnkleElbowHandsShockAfterSyrupNauseaBrokenBittenBeforeTabletFingersTwistedCapsuleShoulderInfectionBlood TestSide AffectsOn the InsideAny allergiesOn the OutsideCardiad ArrestBlood PressureCold (having one)Allergic Reaction

Spelling list 2022-08-07

10 Items: a place to keep fishto make a place cleana tool to sweep the floora place for eating picnicsthe written words of a playa plastic or glass containeran area where you buy presentssomething that stores chemical energypaper and other garbabe on the grounda letter containing messages of good wishes

Cat Word Search 2022-09-22

82 Items: ivcatappdnacellraysscanmarsmoonnasarisktoolzebrastormfieldfocusforcegaugeliverlunarfieldmetalmodelmotororganhippovesselattackimpairinducekidneymarkermusclePlanetrodentsystemtissuevacuumaspirinbladderchronicculturegravitymercurysymptomtropicsvitaminweatherelephantchemicalconstantdiagnoseengineerinternetmutationparticlepressuresoftwareastronaut...

Sabah Oxygen - P1TA18 2024-07-08

102 Items: tophoseventtesttripzeroworkareadownlevelicingtopupnightshiftinertentryvalveplantspacesmokephonespeedlimitalarmcraneshoesupdateonlinebypassliquidbottomweightdialogvacuumoxygenhealthsafetyleaderpermitenergyheightsourcemobileglovesofflineisotankstandbymorningpurgingreactorstartupprocessdrivingvehicleprojecttoolboxliftingcoolingglassesleathernitrogen...

unit vocab 2025-02-04

19 Items: is activity thatis a popular weight-lossis an intense fear of gaining weighthaving a Body Mass Index of over 30.involves short intense bursts of activity.is using food to relieve negative feelings.means having a Body Mass Index of between 25 and 29.9the heart and breathing rate for at least 20 minutes....

Physics Term 1 Revision 2024-01-12

16 Items: Heat energyInside atomsOpposes motionEnergy of motionEnergy from the sunStored energy in foodPulling force in a ropeEqual forces, no motionReturns to original shapeForce that pulls things downForce that attracts or repelsThe planet closest to the SunThe planet furthest from the SunEnergy because of flow of electrons...

pathophysiology 2025-02-15

15 Items: a pocket of pusinflammation of the skininfection caused by mitesinfection caused by fungusinfection caused by a virusan abnormal mass of tissuestype 1 hypersensitivity reactioncontagious growth, caused by HPVA type of skin lesion in epidermisparasites that feed off human bloodinfection common in children/infants...

spelling list 2024-09-13

14 Items: having 2 leaveshaving 8 leavesto strip of leaveshaving five leavesa three leaf cloverhaving only one leafpages of a manuscripta thin sheet of metalall the leaves of a plantthe process of forming a leafa leaf composed of four leafletsa chemical that causes green leaves to dropa portable case for carrying sheets of paper...

Unit 4 Key Terms (Question/Answer Style) 2025-11-04

20 Items: Strain or straining force.Changing from a liquid to a vapor or gas.An interacting group of living individuals.The shortage or absence of something essential.An organism that is capable of making its own food by photosynthesis.The act, art, or manner of managing or handling; controlling or directing....

LOVE ISLAND TINGS 2025-07-13

12 Items: YOU'REFRIENDSHIP OR REAL LOVE?FINISH THE PHRASE "AMAYAWHICH ISLANDER IS A LEO MANFINISH THE SENTENCE HURRICANEWHICH ISLANDER IS A PISCES MANFIRST PERSON DROPPED FROM THE VILLA BELLE-AFINISH THE PHRASE "GOD FORBID I'M A SENSITIVEWHAT DAY OF THE WEEK DOES LOVE ISLAND NOT AIR?WHICH ISLANDER IS A DAY TRADER AND A MODEL CHELLEY...

Homeostasis 2024-11-28

11 Items: a chemical messengera change in the environmentmuscles or glands, make changesthe control of blood water levelsthe control of blood glucose levelswhat enzymes do in high temperaturesthe control of internal body temperaturecells that detect a change in environmentdetect, correct (HORMONE), back to normalthe organ with the highest glucose consumption...

annie's word search 2024-05-16

15 Items: atomic mass unithigh temperature gasprotons and neutronsprotons and electronspostively charged atomsneutrally charged atomsnegativelty charged atomsa table of chemical elementsa mass of atom of a moleculeessential to living organismscharging a object without touching ita way of representing atoms or molecules...

Sci 2024-05-21

10 Items: of, worked by, charged with, or producing electricity.energy which a body possesses by virtue of being in motion.the chemical element of atomic number 30, a silvery-white metala coherent, typically large body of matter with no definite shape.the energy contained within a system that is responsible for its temperature...

First Aid Basics 2024-09-23

25 Items: Burns caused by heat exposurePain reliever and fever reducerBurn which damages the epidermisVaccine given to prevent tetanusAutomated external defibrillatorsBurns caused by friction on the skinInitial care given for an illness or injuryWhen a poisonous substance contacts the skinWhen a poisonous substance contacts the eyes...

Bed Bug 2023-01-06

15 Items: Treatment MethodsTreatment methodsBlood sucking pestPrepay Invoice for BBInvoice for oneshot BBInvoice for incasementsHow do K9's detect Bed BugsWhat document has the k9 pricingHours we schedule a BB eval withinWhat is needed in order to scheduleWhat must be completed before treatmentEvidence of BB, even if not seeing them...

Predetermined fart smells 2025-10-04

117 Items: myandbetbarduefoxwinGoatTreetoothornnestgoalsuitwavebeltrootzonetosswordpumplovearmybeamechoTheretheirFunkycheatvisitjellysnailguiltsmashstartamplespiteblaststickflingtastydoubtdirtypleadscorepriceSmilesSimilegaragescrapedeletethroatlocateinjectformalborrowexcusestablecarpetsummerremindrocketstickyclosedtrumpetretreataveragerespectinquirycrevice...

chapter 2 basic chemistry vocab 2023-09-25

14 Items: the outermost shell of any atomAnything that takes up space and has massnumber of protons within the nucleus of an atomScientific study of the properties and behavior of matterA substance that can't be broken down by non-nuclear reactionsthe mass of an atom of a chemical element expressed in atomic mass units...

Final Review Word Search 2024-05-16

15 Items: solid to a gasgas to a solidEnergy of motionMr.Ferdinandi's birthdayhow tightly packed atoms arethe building blocks of matterwhen thermal energy is releasedwhen thermal energy is releasedhow much space an object takes upthis goes on the y axis of a graphthe ability to do work or cause changechange in the chemical structure of matter...

chapter 2 basic chemistry vocab 2023-09-25

14 Items: the outermost shell of any atomAnything that takes up space and has massnumber of protons within the nucleus of an atomScientific study of the properties and behavior of matterA substance that can't be broken down by non-nuclear reactionsthe mass of an atom of a chemical element expressed in atomic mass units...

chapter 2 basic chemistry vocab 2023-09-25

14 Items: the outermost shell of any atomAnything that takes up space and has massnumber of protons within the nucleus of an atomScientific study of the properties and behavior of matterA substance that can't be broken down by non-nuclear reactionsthe mass of an atom of a chemical element expressed in atomic mass units...

unit1 2025-10-16

13 Items: Unit of energyOrganisms that are eatenA physical characteristicOrganisms that create foodObtaining nutrients from foodAn organism's genetic informationThe chemical reactions in the bodyItems necessary to fuel an organismresponse to change in the environmenta behavior or trait that helps an organism survive...

a to z 2023-01-18

27 Items: EngineerEngineer radio noiseControl Engineer Their typical duties include assessing the production process,Tunnel Engineer y making careful measurements of the forces on a model of the aircraft.Engineer Electrical engineering is an engineering discipline concerned with the study, design,...

Physics Challenge 104 words 2025-07-14

104 Items: ohmlawsungastimeAtomBetaloopheatmarsstardustraysForcespeedForceWavesHertzAlphaGammavoltsgraphspaceearthvenusplutopolesNewtonProtonGMtubeampereseriesEnergyjouleschargesaturnuranusnebulacometsgalaxyGravityDensityNeutronIsotopecurrentvoltagecircuitkineticnuclearelasticaveragecoulombdisgrammercuryjupiterneptunemagnetsVelocityMomentumdistanceFriction...

Safety Terms Word Search 2025-09-02

55 Items: OVAfiresmokehazardcogentincidentcontrolssecuritycode-redconvergecode-greyspill-kitwork-safecommitteeevacuationleadershipfire-doorsmock-codeselectricityinspectionscode-purplearea-wardenchief-wardenfire-curtainconsultationde-escalationcommunicationgas-cylinderssafety-cultureriskman-reportmanual-handlingdangerous-goodssafe-work-limitrisk-assessment...

ENERGY SOURCES 2025-03-26

20 Items: Limited supplyUnlimited sourcesPower from the sunOrganic waste as fuelAtom-splitting energyAncient organic matterPower from ocean tidesEarth’s heat for energyWater-driven electricityUse wind to generate powerAir movement generates powerStore and supply electricityChange voltage in power systemsConvert sunlight into electricity...

Lesson 1-4 2025-07-13

4 Items: bacteria, waste, produce, chemical, raise, celebrate, experience, try, staypermission, comment, etiquette, nervous, interested, filter, expression, bother, awesome,vegetable, recipe, salad, appetizer, culture, recommend, balanced, nutrients, ingredients,tradition, meaning, gesture, respect, greeting, environment, recycle, pollution, conserve,

Geology Word Search 2024-12-11

16 Items: Parent RockForm over warm waterFunnel-shaped vortex cloudFast moving volcanic mud flowMakes up most of earth's crustLarge cracks that form in rocksCool, strong outer layer of earthMagma becomes this after eruptionCompass direction of a rock layerOccurs when water dissolves mineralsphysical removal and transport of rocks...

Fahrenheit 451 Word Search 2024-01-16

10 Items: Montag's selfish wifeThe girl who was killedA device used to shoot fireA retired English professorA chemical used to burn thingsThe captain of all the firemenThe main character of the storyA group of people who burned the booksA fireman who is responsible for burning other people's houses...

Mineral Word Search 2024-12-02

6 Items: Land won ore, Marine won ore, Sustainable, Parent material, PhysicalOrganic, Composition, Luster, Streak plate, Mohs, Cleavage, Fracture,Sheet, Rill, Ephemeral, Gully, Streambank, Conservation tillage, CropContour plowing, Conservation buffers, Windbreaks, Terracing, WetlandsParent rock, Bedrock, Erosion, Runoff, Irrigation, Salinization, Creep,...

Atom Word Search 2025-04-16

15 Items: Particles with an electric charge of +1Particles with an electric charge of -1The vertical columns in the periodic tableSmall positively charged center of the atomElectrically neutral particles in the nucleusThe horizontal rows of elements in the periodic tableThe number of protons in an atom’s nucleus is equal to...

health 2024-12-16

13 Items: bigskinnynon-meat eatersugar moleculesyou are thirstycapable of dissolving in waterolive, safflower, and sunflower oila solid chemical element or compoundinformation of the number of grams of fat etcthe act or process of nourishing or being nourishedthe things that a person has to do or deal with at one time...

Urticaria Word Search 2025-06-15

15 Items: Another name for EczemaConnection between bonesproliferation of basal cellspainful infection on the fingersChronic inflammatory skin disorderfluid-filled sacs to add extra cushionlateral pads in some joints to stabilizefungal infection associated with diabetesosteoblast-rich lining of medullary cavityconnective tissue covering over the bone...

CELL CYCLE 2025-01-07

18 Items: double helixresting phasemeans "one part"means "many parts"life activities of a cellbuilding block of proteinprovides quick energy for cellcarries DNA message to ribosomecarries amino acids to ribosomebuilding block of nucleic acidsDNA replicates during Interphasecell divides into 2 identical cellsa structural component of ribosomes...

Vocab 16 ICP 2025-04-24

15 Items: Particles with an electric charge of +1Particles with an electric charge of -1The vertical columns in the periodic tableSmall positively charged center of the atomElectrically neutral particles in the nucleusThe horizontal rows of elements in the periodic tableThe number of protons in an atom’s nucleus is equal to...

Science Word Search 2025-10-16

15 Items: educated guesshole hhghfhrghrfnfto test a hypothesisthe energy sound carriesenergy stored in nuclear atomsenergy that's in a electric currentobject in motion will stay in motionenergy due to motion and interactionanother name for the first newton lawstored energy of an object or materialenergy carried by electromagnetic waves...

Science Word Search - Trisha 9B 2024-06-11

15 Items: NADNcioiAbtathiTsiceengOlvatencTulaiopopnDaptiaotnaRosommeochused to measure voltageused to measure currentare the basic particles of the chemical elementsis the process by which a liquid turns into a gasthe energy that moves from one place to another in a form that can be described as waves or particles...

Skin Disorders 2025-09-28

15 Items: Parasitic mite infestation causing intensely pruritic burrows in the skin.Warts caused by human papillomavirus , often on hands, feet, or genital areas.Autoimmune disease causing blisters due to loss of cohesion between epidermal cells.Viral infections causing painful vesicles, commonly known as cold sores or genital herpes....

Cat Word Search 2024-10-10

8 Items: Battery-operated vaping device.Plays a role in memory and learning.The primary addictive chemical in tobacco.Is the residue left after tobacco is burned.Smoking tobacco is the leading cause of this disease.This increases consumption and reinforces the addictive behavior.Hand-rolled tobacco in a tamburi leaf tied with colorful strings on its ends....

types of reaction 2023-05-04

4 Items: reactionsreactionsreactionsreactions

Illuminated Books 2024-09-30

11 Items: Pens used by the MonksMonks who wrote the TextsNatural Chemical used for ColouringMarks made in the Margins of a BookRich Aristocrats Commissioning WorksThe Person who Invented The Printing PressDistinctive style of Illuminated ManuscriptsBeing Unrelated or Neutral in regards to ReligionByzantine Illuminated Manuscript dating from the 10th Century...

Psych/Psyche 2025-12-08

9 Items: mind spirithuman soul or mindoccurring within the mindstrange and weird, like hallucinationsa spiritual guide for souls to the place of the deadaffecting the mind, especially a medicine or chemical substancedescribing illness with physical symptoms but apparently mental causes...

science review wordsearch 2023-06-01

22 Items: Unit for workThe transfer of heat in the form of wavesHighly reactive nonmetal elements in group 17Solution that has more solute than the solventHow tightly packed the atoms are in a substanceDescribes both the speed and direction of an objectReactions that release thermal energy when they react...

U6 Homeostasis 1 Wordsearch 2022-11-15

21 Items: increase the speed of enzymesmolecule that an enzyme acts uponable to dissolve in other substancesThe energy needed to start a reactionsmaller pieces of something larger, that make it upa state of balance of the internal conditions of an organismenzymes are specific to the molecules in which they work upon...

7th Energy Word Search 2025-11-18

21 Items: Stored energyBall on a hillEnergy in motionFossil fuels, foodEnergy through heatSpring or rubber bandCurrents in a circuitStored in the nucleusCar moving, skateboardPart that is being studiedMovement of thermal energyHeat transfer through fluidsEverything outside the systemHeat transfer through direct contactLight, electromagnetic waves from sun...

Energy Transformations & Transfers 2024-10-16

14 Items: Energy in atomsEnergy of motionEnergy stored in breadEnergy at the top of a hillA middle point on a pendulumKinetic plus potential energyA form of electromagnetic radiationEnergy changing from one type to anotherEnergy moving from one object to anotherEnergy that an object gives off as it movesWe cannot make more energy or _________ any...

CJ 1 Chapter 2 Vocab 1 2023-06-23

11 Items: group exhibiting certain valuessociety creates crime and criminalstreats drug abuse as a mental illnesscriminal who commits multiple offensescriminal laws are designed by those in powerdrug offenders harm society by their actionsthoughts and actions are attributed to unconscious motives...

PTE Arrangement 2024-09-09

20 Items: How many elements are there today?The periodic table have _____ rows.Elements are placed based on their what?Different types of atoms are called what?How many columns does the periodic table have?What is the first element on the Periodic Table?Each Row of the Period Table is called a ______.Periods represent the energy level of _________....

Infection Control 2022-11-02

20 Items: To dispose ofSafety Data SheetAn item that is reusableAn item that is disposableAmount of time to disinfectQuaternary Ammonium CompoundsThe ability to produce resultsEnvironmental Protection AgencyThe transfer of harmful bacteriaCaused by streptococcus bacteriaCan be used again and disinfectedKills certain pathogens on surfaces...

Most Common Words That Start With C Part 1 2025-05-02

119 Items: cancapcarcatCEOcakecallcampcardcarecasecashcastcellchefchipcitecityclubcluecabincablecarrycatchcausechainchairchartchasecheapcheckcheekchestchiefchildcivilclaimclasscleanclearclimbclockclosecloudcameracampuscancercarboncareercenterchancechangechargecheesechoicechoosechurchcircleclientclinicclosercabinetcapablecapitalcaptaincapturecarefulcarrier...

My Motion and Machine word search. 2025-10-18

16 Items: to put togetherto go up and outa machine that helps lift thingsplane- a machine that moves objectsa simple machine that goes up and outis a movement from one position to another.( The scientist) First Law of Motion states:- is any applied force that moves an object.- are any type of device/technology that makes work...

Acids and Alkalis 2023-09-16

13 Items: a soluble basehas a pH below 7has a pH above 7has a pH of exactly 7acid that contains a lot of watercolour litmus paper turns in acidscolour litmus paper turns in alkalisacid that doesn't have a lot of watera reaction between an acid and a basean example of an acid we use in the laban example of an acid you find in the kitchen...

Culture shock in an unlikely situation: Australia to Canada 2025-06-05

5 Items: Kind or pleasant, as Canadians are known for.A chemical used for washing dishes or clothes.Not ready (how Emily felt when she moved to Canada).Easy to see or understand (Where garbage bags were not)A large group of people (it can be hard to get in THIS)

Health and Wellness 2025-05-30

10 Items: The state of being in good health.The body's ability to resist diseases.Emotional and psychological well-being.Practices that keep you clean and healthy.A shot that helps protect you from diseases.The process of absorbing enough water for health.The condition of being physically strong and healthy....

Writer 2022-11-05

11 Items: the lower jawsurgical removal of bone or tissueswelling; usually secondary to infectionsubstance that joins two or more surfacesa relatively narrow tubular passage or channelthe hard and soft tissues forming the roof of the mouthlightening of the teeth using a chemical oxidizing agentmissing tooth structure due to decay, erosion or abrasion...

Food Safety Chapter 1 2025-08-28

11 Items: a bad microorganisma hazard like bleacha type of temperature abusea hazard like hair or plasticbacteria like parasites or moldanything in your food that doesn't belong therepoor personal _____, not washing hands regularly____illness, an illness you can get from eating bad fooda very small living thing only seen through a microscope...

Neurons!!! 2023-11-30

13 Items: places on axon with no myelinmain control center of a neuronsends message from cell body to knobgap between a neuron and another cellwhen the axon briefly becomes positivefingers of cell body sending message incovering on axon that speeds up messagessends chemical message across the synapsepotential when the axon is negative inside...

Rates of reaction 2025-10-08

1 Item: reaction, concentration, particle, reactants, temperature, balance, syringe, surface area, catalyst, enzyme, collision, mass, volume, pop, limewater, relight

Clinical Chemistry Automation and POCT 2024-06-11

18 Items: Term describing near patient testingQuality measure to ensure accuracy and precisionStep in the total testing process where testing occursAn analyzer methodology based on the rate of the reactionPart of the analyzer which aspirates the sample from the tubeThe number of samples or tests that can be performed per hour...

20 of my most challenging words form 2023 2023-12-06

20 Items: to be givena reverse movementnot alined proplelyan expert in scientsto be full of glamoura person who fixs teethto be scade of somethinga rainforest in queanslandto let someone do somethingbefore what has just happenda animal that lives in africaa animal that lives in the seafuels a fuel made out of fossilsto see something that is obviose...

Acids and Bases 2025-03-27

15 Items: ph of 7ph below 7ph above 7ph is in _____ of tensph of a neutral substancewhat we trying to neutralizered cabbage is an example of this- what acids and bases are to skindigital device that tells you the pha kind of indicator we use to test pHwhat color litmus paper turns when an acidwhat color litmus paper turns when an base...

Physics word search 2025-06-14

28 Items: - When atoms decide to form a group chat- How often you check your phone per minute- How loud your neighbor's music is at 2 AM- What your body has to waking up on Monday mornings- What happens to your heart rate during a physics exam- The reason you're still on the couch watching Netflix- Why your room gets messy faster than you can clean it...

October Word Search 2025-05-25

20 Items: Emma's new surnameOur go-to takeawayWho is the tidiest?Month Louis proposedThe month that we metThe town Emma is fromThe city Louis is fromWho is the better cook?Our minimoon destinationThe name of city we met inThe name of our cat friendOur first sports game togetherThe football team Louis supportsThe name of the village we live in...

Unit 3 Vocab 2023-09-14

20 Items: (adj) roundabout, not direct(v) to make amends, make up for; to avert(v) to make easy, cause to progress faster(v) to have an intense dislike or hatred for(v) to assign or refer to (as a cause or source), attribute(adj) bitter, sarcastic; highly caustic or biting; acerbic.(n) a natural inclination or tendency; penchant or propensity....

Spelling & Vocabulary Wk. 6 2025-09-02

10 Items: an emotional state or reactionIn advance: At an earlier time.(noun) Coins opposed to paper currency(verb) get, acquire, or secure (something).(plural noun) Piece of land, surrounded by wateron, onto, or within a vehicle (such as a car or ship)(verb) describe item by item, give the full particulars of...

Communication in Law Enforcement 2025-08-21

12 Items: Words used in a messageIntended target of the messagePerson with a message to conveyMedium used to transmit messageProcess of exchanging informationInformation or idea being communicatedResponse receiver provides in reaction to the messageWords and expressions used by a particular vocation or group...

Intro to Physics and Matter & Interactions 2023-06-15

7 Items: Career related to Physics.Any quality or characteristic.Physics studies the ________ world.Everything around us is made of _______.Is used in Physics to model observations and make predictions.An example of a chemical property of matter. Related to how dangerous a substance can be....

NUR155 Miss Brown Exam 2 Vocabulary 2024-11-05

41 Items: Low SodiumIrrigationFiltering UnitLoss of appetiteInflammation of a veinCan cause renal calculiWound Ostomy Care NurseDifficulty in swallowingCauses cellular swellingAny fat found in the bodyPulls water from the cellShould look red and beefyMalignant growth in colonNarrowing of blood vesselsSurgically created openingInability to control urine...

Unit 8 2024-04-25

9 Items: Reprocessing of waste into new, useful productsFlow of all wastes produced by the average persontype of waste with mostly household and commercialtype of waste with mostly chemical and constructiontype of waste with manure, crop residue, dead livestocktype of waste with tailings, overburden, broken equipment...

Fatigue Word Search 2024-04-02

10 Items: Individuals who care for patientsNo reaction from the nursing staffNosies used to alert the nursing staffwhat serves as the "big culprit" of alarm fatiguePlaces that houses patient for care until dischargedwillingness to accept responsibility for one's actionsNeeded to help decrease fatigue and unnecessary alarms...

Force and Motion 2025-05-22

13 Items: A push or a pullSpeeding up or slowing downSpeed in a certain directionThe time it takes for motion to happenA force that resists an object's motionThe scientist who created laws of motionThe law of Newton's that is about inertiaThe change in an object's position over timeThe energy something has based on its height...

Rates of reaction 2025-10-08

1 Item: reaction concentration particle reactants temperature balance syringe surface area catalyst enzyme collision mass volume pop limewater relight

Cell Energy Word Search 2025-02-21

18 Items: Requires oxygenDoes not require oxygenForm of energy for a cellLocation of the Calvin CycleFermentation common in plant cellsFermentation common in animal cellsOxygen is a by-product of this processLocation of the light-dependent reactionVital for animal life, produced by plantsOccurs in the cytoplasm to start respiration...

Equalforces Word Search 2025-12-16

17 Items: to take inwhen light bendsto bounce off a surfacea form of energy we can seean object that stores energya form of energy we can hearthe stored energy an object hasforces that have the same strengthforces that have different strengthsa device that opens and closes a circuita form of energy measured by temperature...

Energy Review Word Search 2025-05-12

9 Items: Energy possessed by hot objects.Form of energy possessed by moving objects.Energy stored by doing work against a force.Energy stored in chemical elements and compounds.A way energy is transferred in the form of sound.A way to transfer energy using an electric current.Energy stored by lifting an object against gravity....

education 2025-10-27

19 Items: Synonym of test.The study of numbers.To study for an exam.A mark on an exam or course.School after primary school.The opposite of public school.The days and times of classes.The opposite of pass (a test).After an exam, you get the _____.University graduates have a _____.A period of time in a school year.The study of novels, plays, poetry....

Health and Wellness 2025-04-14

10 Items: WELLNESS : The state of being in good health.IMMUNITY : The body's ability to resist diseases.HYGIENE : Practices that keep you clean and healthy.MENTALHEALTH : Emotional and psychological well-being.VACCINATION : A shot that helps protect you from diseases.HYDRATION : The process of absorbing enough water for health....

Camp Tucker Week 7 - Science Week Word Search - 2 2025-07-17

132 Items: DNAATOMCELLDATAFACTHEATIDEALAWSLIFEMASSCLAIMEARTHFORCEGENESGRAPHLIGHTMODELPHASEPLANTSCALESOUNDSPACEANIMALBEAKERBONDEDBOTANYBURNERENERGYFOSSILFUNNELLIVINGMAGNETMATTERMOTIONRECORDRETORTTHEORYTISSUETRACESANALYZEBIOLOGYBURETTECLIMATECUVETTEDIAGRAMDIORAMAELEMENTGEOLOGYGRAVITYMEASUREMINERALMIXTURENATURALOBSERVEPHYSICSPIPETTEREMAINSRESULTSSCIENCEZOOLOGY...

Energy Word Search 2025-11-17

24 Items: Heat energyLight energyTop of a waveHow energy movesHeight of a waveBottom of a waveHow energy movesEnergy due to motionBaseline for the wavesBall rolling down a hillEnergy in food and batteriesEnergy in moving machine partsHow often a wave passes a pointDistance between repeating pointsEnergy stored in the nucleus of atoms...

Spelling list 2024-05-23

20 Items: nation wideattracts metalan act of movingand area of groundany basic substancenonmechanical deviceright now or presenta process in the bodyto represent somethinga way to measure energyphysical force on somethingspeaking between each othersomething that happens anuallyconnect with someone or somethingused in ordinary or basic conversation...

The Great Big Search - Yr 8 2025-12-18

134 Items: GoldZincAtomIronMeltHeatFlowRateCoreRingFireLavaRockGroupWaterMetalLightSoundWasteWavesCellsHeartLungsNasalVilliSmallLargeCrustOuterInnerFieldScaleFocusVentsMagmaCyclePeriodSilverVolumeDiluteMatterSankeySystemSexualSeptumLarynxCavityPlasmaMantlePlatesElementMixtureProductMercuryDensityKineticElasticDiagramThermalNervousTendonsBronchiTracheaPharynx...

Unit 2 Review 2023-12-19

10 Items: Push or Pullyour mass plus GravityUnit to measure force(N)How much "stuff" you are made ofsomething you can build with snowForce that pulls things down to eartha tendency to remain unchanged and has a direct relationship with massFor every action (force) in nature there is an equal and opposite reaction....

Unit 1 Review 2024-09-03

10 Items: When energy is movedThis is stored energyThis is the energy of motionThese carry energy from one place to anotherType of energy stored in the bonds between atomsWhat it's called when energy changes from one form to anotherThis is done to an object to give it Elastic potential energyGravitational potential energy is affected by these two things...

Chemical compounds 2025-12-11

1 Item: acid

Medical English Vocabulary 2025-10-20

64 Items: WadeEisenWundeNähteNarbeHüfteBlaseLungeBrustRötungUnruhemessensterilLeisteGelenkNarkoseStationAtemnotVerbandBlutungSpülungMandelnÜbelkeitSchwächeJuckreizDrainageKatheterStrümpfeInfektionErbrechenSchwindelMüdigkeitberuhigenermutigenSauerstoffSchwellungBlutergusshochlagernüberwachenbeobachtenReizbarkeituntersuchenHarnverhaltNachblutungmobilisieren...

The carboniferous period 2023-10-05

10 Items: Lasted about 60 million yearsthe big land mass before pangeabefore it was called just oxyegeneplant from the carboniferous perioda supercontnant formed from gondwanaa sea animal during the carboniferous periodcorals One of the carboniferous periods animalsa reasource from the earth that is nonrenweable....

October Safety Puzzle 2024-10-02

10 Items: Manifests contain 4 key (8).Retain manifests for (4) years.DOT stands for Department of (14).RMW stands for regulated medical (5).All hazardous material must be accompanied by (9).The name of the company that takes our sharps is (10).There are (4) classifications for hazardous materials....

CH3 - Rocks and Minerals 2022-12-18

16 Items: The layer of rock that forms Earth's outer surface.________________________Process in which sediment is laid down in new locations.________________________A dense sphere of solid iron and nickel at the center of Earth.________________________The layer of hot, solid material between Earth's crust and core.________________________...