cells Word Searches

Word Search 2025-11-17

7 Items: - Main source of energy for cells.- __ process - does not require oxygen.- Molecule that provides energy to cells.- Water movement through the cell membrane.- Gas released that makes the cake batter rise.- Beverage that also undergoes alcoholic fermentation.- Living organisms that carry out the anaerobic process in the bolo-rei.

My 8th Grade 2024-06-05

51 Items: funcnnwebsfrogcastbacacellsearthwatermangotightearthsoundplantreyeslaylajasoncesarerickoxygenhealthnewtonstreetracersforcesmotionanimalfrancovictorclimatemonstersystemsachievevolcanoenglishcursiveaguirremercadorodrigobrandonjournalsadvisoryyearbookesperanzachristiandissectioncollisionsparagraphsvillanuevamicroscopescomprehension

Pigmentation 2025-09-09

21 Items: Pigment granules.Dark brown pigment.Red/orange pigment.Production of melanin.Cell that produces melanin.Referred to as the cuticle, scarf skin.The Stratum _____ is where mitosis happens.Short fibers extending from the nerve cell.These prevent the oxidative action of molecules.The Stratum _____ Toughest layer of the epidermis....

CELL CYCLE 2025-01-07

18 Items: double helixresting phasemeans "one part"means "many parts"life activities of a cellbuilding block of proteinprovides quick energy for cellcarries DNA message to ribosomecarries amino acids to ribosomebuilding block of nucleic acidsDNA replicates during Interphasecell divides into 2 identical cellsa structural component of ribosomes...

Pigmentation Word Search 2025-09-09

21 Items: Pigment granules.Dark brown pigment.Red/orange pigment.Production of melanin.Cell that produces melanin.Referred to as the cuticle, scarf skin.The Stratum _____ is where mitosis happens.Short fibers extending from the nerve cell.These prevent the oxidative action of molecules.The Stratum _____ Toughest layer of the epidermis....

GCSE Biology Word Search: The Heart, Blood & Stem Cells 2025-07-14

31 Items: VeinHeartAortaValveBloodPulseAtriumSeptumArteryOxygenPlasmaDivideVenaCavaCoronaryRedCellsStemCellVentriclePulmonaryCapillaryPlateletsDiffusionPacemakerWhiteCellsMyocardiumBoneMarrowTransplantCirculationSpecialisedRegenerationCarbonDioxideDifferentiate

Esthetics: 105 Anatomy & Physiology A 2024-04-17

53 Items: skincellsorganbrainheartlungsliverbonesveinstissuesystemkidneyspleenanatomynucleusmitosismeiosisstomachovariesribosomearteriespancreashistologypathologycytoplasmcentrioleanabolismintestinephysiologymetabolismprotoplasmchromosomecatabolismnervetissuecapillariesgrossanatomycellmembranemitochondriacardiacmusclenervoussystemmusculartissueskeletalsystem...

Training for Aerobic Endurance 2025-11-04

42 Items: atppaincellsbloodbloodpowerspeedoxygeninjurysportsvolumeplasmastressfartlekathleteaerobiccardiacelastickineticfatiguelactatetissuesstrengtharteriesdurationsorenesstaperingarterialdiabetespressureendurancethresholdendurancehemoglobinhematocritglycolysisperformancecapillariesexplosivitymitochondriapsychologicalcircuit fatigue

Maroonverse Word Search 2024-07-15

56 Items: amymaxeccfoxlukemdecnickswanmaidcoatcomaloresaraheliselyrickarmacellsdemonangelamyrijamesmanorjellysnakeeaglenursemagickaisercobaltathenaskylartraumaferretmaroonrozipelequinoxlaudinetestingcaptiveleopardkimberlyludocielsolitarykaleenahprisonerlucideoushexiquiritrauzelexoveprimeucrythtinechameleonexecutionraphtailiacontainmentcompetitionexperiments

Anatomy and Physiology for Aesthetics 2025-09-06

58 Items: hairSkinorgannervenailscellshumanBrainHeartLungsSkulltissuemuscleorgansKidneynucleusmitosiscorneumlucidumnervoustissuessystemsStomachMusclesThyroidOvariesspinosumskeletalmuscularsensationexcretionsecretionpapillaryreticularlymphaticendocrinedigestiveexcretoryprotoplasmconnectiveepithelialprotectionabsorptiongranulosumLymphocyteLymphNodescirculatory...

Immunology Word Search 2024-03-13

15 Items: Immunoglobulin producing cellsProtein encoded by HIV gag geneGold standard test for screening SLECells responding to parasitic infectionsSarcoma associated with HHV-8 infectionsAntibody is in excess compared to antigenMost abundant immunoglobulin in adult serumRegion of immunoglobulin that binds antigensMediator of Type I hypersensitivity reactions...

ITS ALL ABOUT MICROSCOPIC LIFE 2024-03-01

22 Items: The powerhouse of the cellSingle Celled microorganismsone-celled aquatic organismsGreen pigment in plants and algaea substance capable of causing cancersmallest unit that can live on its ownMaterial within a living cell-jelly-likeSmall common fly found near rotted fruitViruses that infect and replicate in cells...

General Science 2024-04-03

59 Items: gaslakecellatommassmeltcellsbonesrocksoceanorgangenesforcespeedcloudsystemtraitsenergyfreezebiologygeologynucleusproteinalleleselementgravitykineticmineralssedimentmembraneribosomegeneticsdominantmoleculeparticlehydrogenchemistrydigestivecytoplasmrecessivepotentialscientistexperimenthypothesisorganelleschromosomemechanicaldepositionrespiratory...

HEMO/HEMA Roots Words 2025-10-29

14 Items: bloodhematichemotoxichemorrhagehemoglobinhemophiliahemostasishematologistblood poisoninga large amount of bloodfound in red blood cellsin which blood does not clot properlystoppage in the first stage of wound healingwho studies blood and treats blood disorders

this will kill more brain cells than the state test 2023-12-08

250 Items: adaeafagaceacmactadaaddadsageavebadableaceracidacneacreactsadamaddsadslagedautoawaybabebabybackaaronaboutaboveacidsacresactoracuteadamsaddedadminadmitadobeadoptadultafteragainagentautosavoidawardawarebabesbaconabroadabsentaccentacceptaccessacrossactingactionactiveactorsactualaddingadidasadipexadjustadrianadultsadvertadviceadviseadwareaerialaffair...

Contamination Word Search 2025-08-30

57 Items: PPEHatFQCIQCOQCSetIPAEVAIPQCLGVSCellPushPullSortLOTOPaperCellsPortsCrossGlassLightOrderShineSolarPowerLabelDentsGlovesModuleBusbarSolderHazardOrganicTabbersPackingCornersPalletsSamplesMachineCurtainSustainSortingClusterBubblesGuardingForkliftEquipmentBacksheetConnectorScratchesLaminatorsProductionSupervisorStandardizeEnvironmentContamination...

Histology 2024-12-11

47 Items: FibersAreolarAdiposeRegularElasticHyalineNeuronsExocrineApocrineHistologyEndocrineMerocrineHolocrineReticularIrregularNeurogliaFibrocytesOsteocytesMast CellsGoblet CellBlood CellsFree SurfaceTransitionalChondrocytesSpongy BonesMacro-PhagesBasal SurfaceCompact BonesSmooth MuscleNervous TissueCardiac MuscleMuscular TissueSimple Squamous...

Integumentary System 2025-10-06

23 Items: oil glandsmeans "covering"deepest skin layerthe outermost layer.indent the surface abovesuperficial dermal regioncells that produce keratincomposed of adipose tissuemostly dense connective tissuedeepest cell layer of epidermiscapable of becoming hard and tougha more superficial layer not granulatedvery numerous and found all over the body...

Word Search 2024-05-16

11 Items: makes the bloodregulates your bloodCarries blood to the heartCarries blood away from the heartwhen arteries become little arteriesthey are responsible for blood clottingjoin the smallest arterioles and venulesthe protein in red blood cells that contains ironthe liquid part of the blood which is made up of water...

WORD HUNT 2014-08-23

60 Items: LIFEGENESMOKELIGHTBLOODLUNGSCELLSVEINSWATERHEARTPLASMAENERGYASTHMASTROKESTROMAMENDELGRANUMOXYGENDIPLOIDALLELESALVEOLIEXTINCTSPECIESBRONCHIHABITATHAPLOIDHEREDITYDINASOURACIDRAINDOMINANTLEUKEMIASUNLIGHTGENOTYPEOILSPILLDIAPHRAGMPOLLUTIONKARYOTYPEKREBSCYCLEENDANGEREDTHAKALOIDSGLYCOLYSISVULNERABLEPYRUVICACIDCALVINCYCLECHROMOSOMESCODOMINANCEINSECTICIDES...

Gametogenesis 2024-11-03

30 Items: Germ-cellPolar-bodyLeydig-cellsLuteal-phaseCorpus-luteumPrimary-oocyteSperm-producingSertoli-supportOvum-productionMenstrual-cycleOvulatory-phaseSecondary-oocyteFollicular-phaseMeiotic-divisionZygote-formationGraafian-follicleGamete-maturationDiploid-to-haploidTesticular-functionChromosomal-halvingPrimary-spermatocyteReproductive-process...

this will kill more brain cells than the state test 2023-12-08

250 Items: adaeafagaceacmactadaaddadsageavebadableaceracidacneacreactsadamaddsadslagedautoawaybabebabybackaaronaboutaboveacidsacresactoracuteadamsaddedadminadmitadobeadoptadultafteragainagentautosavoidawardawarebabesbaconabroadabsentaccentacceptaccessacrossactingactionactiveactorsactualaddingadidasadipexadjustadrianadultsadvertadviceadviseadwareaerialaffair...

Cat Word Search 2025-09-25

6 Items: theorySchwannSchleidenBiologistliving things are composed of cells and cell productsspontaneous generation using beakers with necks Louis Pasteur

Sciences of the World: Gmo's and Cells! 2016-02-21

10 Items: GRASGenomeGeneSplicingModificationBiotechnologyCrossBreedingrecombinantDNASelectivebreedingGeneticengineeringGeneticallyModifiedFood

Word Search 2024-05-16

15 Items: makes the bloodhelps bend your armregulates your bloodconnects bone to boneconnects bone to muscleCarries blood to the heartCarries blood away from the hearthelps you ift things over your headwhen arteries become little arteriesthey are responsible for blood clottingjoin the smallest arterioles and venules...

this will kill more brain cells than the state test 2023-12-08

250 Items: adaeafagaceacmactadaaddadsageavebadableaceracidacneacreactsadamaddsadslagedautoawaybabebabybackaaronaboutaboveacidsacresactoracuteadamsaddedadminadmitadobeadoptadultafteragainagentautosavoidawardawarebabesbaconabroadabsentaccentacceptaccessacrossactingactionactiveactorsactualaddingadidasadipexadjustadrianadultsadvertadviceadviseadwareaerialaffair...

this will kill more brain cells than the state test 2023-12-08

250 Items: adaeafagaceacmactadaaddadsageavebadableaceracidacneacreactsadamaddsadslagedautoawaybabebabybackaaronaboutaboveacidsacresactoracuteadamsaddedadminadmitadobeadoptadultafteragainagentautosavoidawardawarebabesbaconabroadabsentaccentacceptaccessacrossactingactionactiveactorsactualaddingadidasadipexadjustadrianadultsadvertadviceadviseadwareaerialaffair...

Life Science 2023-06-12

63 Items: dnaatomgenepreycellsclaimplantanimalbiomesdarwinfossilsafetyelementfoodwebmeiosismitosisnucleusosmosisproteincompoundconsumerdominantecosytemevidencegeneticsomnivoreorganismpredatorproducercarnivorecommunitydiffusionevolutionherbivorelabskillsreasoningrecessiveadaptationeukaryoticmicroscopepopulationwatercyclecarboncyclechloroplastnucleicacid...

Maroonverse Word Search 2024-07-24

60 Items: amymaxeccfoxlukemdecnickswanmaidcoatcomaloresaraheliselyrickarmacellsdemonangelamyrijamesmanorjellysnakeeaglenursemagiccobrakaisercobaltathenaskylartraumaferretmaroonbreachrozipelequinoxlaudinetestingcaptiveleopardkimberlyludocielsolitarykaleenahprisonerfacilitylucideoushexiquiritrauzelexoveprimeucrythtinechameleonexecutionsalvourneraphtailia...

Avalyn 7th Grade science 2024-05-15

15 Items: Regulate TempatureTo straighten your armThird level of organizationFourth level of organizationMakes lipids and detoxifies poisonsWhite blood cells to fight infectionMakes proteins and lipids for the cellTraps sunlight and converts it to sugarTransports iron, oxygen, waste, nutrientsIt caries hormones which Carry's messages...

Medical Term Ch 2 2024-01-17

16 Items: Out ofWithinControlThe study ofA specialistGrowth or formationThe study of diseaseCondition produced by diseaseCommonly known as belly button or navelA disease producing microorganism such as a virusProvides protective padding, insulation, and supportThe basic structural and functional units of the body...

Cell Energy Word Search 2025-02-21

18 Items: Requires oxygenDoes not require oxygenForm of energy for a cellLocation of the Calvin CycleFermentation common in plant cellsFermentation common in animal cellsOxygen is a by-product of this processLocation of the light-dependent reactionVital for animal life, produced by plantsOccurs in the cytoplasm to start respiration...

Energy Word Search 2025-10-30

20 Items: What allows us to see. (5)The smallest unit of life. (4)A push or a pull on an object. (5)What makes things warm or hot. (4)The control centre of the cell. (7)An object that attracts some metals. (6)A group of cells that work together. (6)The pull that keeps us on the ground. (7)A state of matter with a fixed shape. (5)...

Med Term 2024-09-09

20 Items: the microscopic study of tissuethe study of the functions of the bodystudy of disease; it’s nature and causesituated on the back/back part of an organcommonly known as the bellybutton or navelsudden and widespread outbreak of a diseasedirected towards or nearer the side of the bodyphysician who specializes in the care of toddlers...

32Squared 2025-02-03

64 Items: catswolfgonedeskciaofirmuponsparcquiettodaybeachlucascellsvaluefluidtracedonnabelowtimingcomplyversuscolumnwickedkernelflavorfinestnumberformeradjustdallasstresswyomingpenaltymailingleadingaustriaorleansdesignsrespectacrobattrustedwebpagediagrammarketsstuffedpurchasesoftwaresportinginsertedenrollednaturalsprofilesinteriortemplatescorporateconsumers...

Year 8 Plant and Animal Cells Wordsearch 2023-11-23

9 Items: cellplantanimalnucleusvacuolecellwallcytoplasmcellmembranechloroplasts

Nutrition Study 2025-12-12

16 Items: (Solid fat)(Bone mineral)(Stored sugar)(Blood mineral)(Bile producer)(Protects cells)(USDA food guide)(Top tier review)(Indigestible carb)(Element in protein)(Simple sugar energy)(Blood sugar hormone)(Energy burned at rest)(The macronutrient ranges)(Building block of protein)(Bad cholesterol transporter)

Microgravity Effects Word Search 2023-05-30

57 Items: masslossnasafloatspacebloodswellnerveheartcellsfluidsmuscleweakenshrinkstraincanalsorgansmotionhealthrhythmmakinggravityeffectsatrophybrittlecalciumbalancesensoryotolithelectricmagneticexposurepressureregulatemineralsmovementresponsescheduleradiationdestroyerdizzinessunbalanceisolationdemandingweightlessastronautsspacecraftatmospherevestibular...

64word 2025-05-30

64 Items: jakeripejuangripringendsadmitfirsthollyaltermonthpollsessayreadyciscocellsassetslenderbananarepeatscriptreportdirectretailamountjumpinginducedexhibitbooleancastingbangbusnamibiadonatedbouquetgratuitcapableexpressargumentamericasplasticscylindermessagesphillipsgenerousnitrogenconsistsedinburghactivatedlimousinescincinnatienterprisebestiality...

Word Search Key Terms 2024-03-05

52 Items: ldlhdltactrategaitsignssignspulsesmellclearcolortriageplasmareflexmemoryvisionborderhistoryempathyfactorshormonehearingstridorrhonchisymptomsdemeanorpressuremovementstrengthresponsewheezingcracklesdiameterevolvingdiagnosiscomplaintleukocyteplateletssensationasymmetrymass indexhemoglobinhematocritmetabolismhomeostasiserythrocytethrombocyte...

Respiratory Anatomy 1 2024-10-18

17 Items: Forms majority of the walls of alveoliThe space between the parietal and visceral pleura.Specialized cells in the alveoli that produce surfactant.A bony structure that forms the floor of the nasal cavity.A flexible tissue that extends posterior to the hard palate,The branching system of bronchi and bronchioles that conduct....

QUIZ 2025-11-28

15 Items: Who pioneered the technique of PCR?Who is known as the Father of Genetic Engineering?What type of tertiary structural protein is Keratin?Which is the least abundant Granulocyte in our body?Which family of organism does Dengue virus belongs to?Gout's disease is caused due to higher accumulation of?...

Two Types of Cells: Prokaryotic and Eukaryotic 2024-09-03

8 Items: DNAcellnucleusorganismorganelleeukaryoticprokaryoticcellmembrane

Cell Organelles 2023-09-12

14 Items: Two organelles that work to help the cell divide.Storage bins where food, nutrients, or waste are kept.Sphere shape in the nucleus. Makes ribosomes for the ER.Flexible material that holds the parts of the cell together.The brain of the cell that controls eating, movement, and reproduction....

Prefixes 2024-09-11

20 Items: redselfveinfastslowlungswithinaroundAgainstbetweenblood vesselbetween statesred blood cellsWithin the veinrelating to the lungsslow beating heart ratefast beating heart rateYou write about your lifedon't won't people around themtake blood from your veins using a needle

potassium b-day 2023-02-14

69 Items: rsccoolnsaayarnswaghipzamarsmartchillcellsalicegracecaringtanniscyroneplayfulkittiesbiologycrochetshoebopactivismlearningknittingdairydomganglandcellularunclularbabayagacellomanpotassiumisoscelescashformecelloularbenevolentthoughtfulashmaezingmoneyformeunclerogerjazzydaddyveinyhandsbutisbobbobsuperclassybillionaireeasanibcaadwordoftheday...

Respiratory System 2024-10-14

29 Items: The movement of air into and out of the lungs.The double-layered membrane surrounding the lungs.The space between the parietal and visceral pleura.Pneumocytes-cells in the alveoli that produce surfactant-A ring-shaped cartilage located below the thyroid cartilageThe first branches of the trachea that lead into each lung....

Characteristics of Living Things 2024-09-05

17 Items: Living things are ________________.Non-living things are _________________.Living things are made of _______________.All living things need ___________________.Living things respond to ______________________.Living things are called ______________________.Living things ________________, or change over time....

Chapter 1 - Organ systems 2025-12-01

10 Items: The ... system coordinates the body's actions.The ... system moves the body and produces heat.The ... system exchanges O₂ and CO₂ in the lungs.The ... system supports the body and produces blood cells.The ... system filters toxic waste materials from the blood.The ... system secretes hormones, which act as chemical messengers....

Chapter 1 - Organ systems 2025-12-01

10 Items: The ... system coordinates the body's actions.The ... system moves the body and produces heat.The ... system exchanges O₂ and CO₂ in the lungs.The ... system supports the body and produces blood cells.The ... system filters toxic waste materials from the blood.The ... system secretes hormones, which act as chemical messengers....

First Trimester 2025-09-24

14 Items: chemicals used to dissolve other substancestakes place when a sperm penetrates the egg or ovumwhen the cell inside the zygote splits and replicates itselfalso called a womb; hollow, pear-shaped organ located in the pelvisejection of a mature egg or ovum from the ovary into the fallopian tube...

1 2023-06-04

71 Items: maxnemoelliselisanadiajamesaleahlucascellsgenespolarchainspeedsophiahayleejaidynaudreyhunterfinleymaddeytraitsmattercirrusbiomesforcessciencenimbrodcharlienervouscumulusstratusclimateweatherestuarygravityinertiafranklinbrooklynmachealajeremiahheredityskeletalmuscularpressuretropicalhumiditymomentumfrictionelizabethdigestiveradiationinsulator...

Intro to Ag Vocab Word Search 1 2025-12-08

74 Items: cowdoejobacidbasebeefcalfcropdatafoodfuellambleafcellschickcreedfaunafieldfloragenesinputbuffercareerdangerdesertembryoenergyexportheiferimportkittenanatomyaquaticcautiondensityerosionharvestinquiryaccidentaccuracybacteriaclassifyconflictdistancelandformlatitudeamendmentcarnivorecommoditydimensionemergencyfeedstuffgrasslandherbivoreincubator...

Sophia Word Search 2023-06-03

71 Items: maxnemoelliselisanadiajamesaleahlucascellsgenespolarchainspeedsophiahayleejaidynaudreyhunterfinleymaddeytraitsmattercirrusbiomesforcessciencenimbrodcharlienervouscumulusstratusclimateweatherestuarygravityinertiafranklinbrooklynmachealajeremiahheredityskeletalmuscularpressuretropicalhumiditymomentumfrictionelizabethdigestiveradiationinsulator...

Cell Cycle and Mitosis 2024-12-15

17 Items: The phase of interphase where DNA replication occursOne of two identical halves of a duplicated chromosomeA structure of DNA and protein that contains genetic informationThe region of a chromosome where sister chromatids are held togetherThe stage of mitosis where chromosomes align in the middle of the cell...

nvrt 2023-10-18

21 Items: polyppermianjurassicphasmidsflagella"false feet"reef-buildingtapeworm headhermaphroditic_________ ooze“little kidneys”having separate sexes_____________ explosionnematode glandular systemsegments in cestode’s bodyfree-living flatworms (Class)“bell form” cnidarian body planalgal symbionts of coelenteratesanterior chemosensory organ of nematodes...

Vocabulary words 2024-12-05

12 Items: a fat protein unita basic fat moleculethe basic building blocks of fatturns vegetable oilds into solidsan amino acid that your body needs but cannot makea food that lacks one or more essential amino acida food that contains all nine essential amino acidsa molecule that combines with other amino acids to make proteins...

QUIZ - ROUND 1 2025-11-29

20 Items: Who invented PCR?What helps bacteria move?Where are sister chromatids joined?Dengue virus belongs to which family?Which hormone causes cell elongation?What is the fungal reproductive unit?Which organ is the throne of immunity?What are the leaf pores for gas exchange?What is a complete virus particle called?substance makes M. tuberculosis acid-fast?...

Mitosis And Meiosis 2024-08-08

17 Items: - The pairing of homologous chromosomes during meiosis.- Protein complexes that hold sister chromatids together.- The failure of chromosomes to separate properly during cell division.- The phase of the cell cycle where the cell grows and DNA is replicated.- The first stage of mitosis where chromosomes condense and become visible....

Hair 2025-10-21

9 Items: hair only found on new born babiesthe pigment found in hair and skin.the first stage of the hair growth cyclethe final stage of the hair growth cyclethe middle phase of the hair growth cyclescale like cells found on the outer layer of the hairthe base of the hair follicle and produces germ cells for the hair....

Neoplasia 2025-05-16

6 Items: disorder arrangement of cellsbenign tumour of smooth musclebening tumour of blood vesselsmalignat tumour of blood vesselsmalignant tumour of smooth musclespread of tumours to distant site

Averroès 2024-11-26

20 Items: EnergyImmuneBiologyCultureSurgeryMoleculeResearchMythologyTraditionDiagnosisDiscoveryExperimentPhotosynthesisThe smallest unit of matterThe study of disease causes and effectsA monumental structure from Ancient EgyptThe protein in red blood cells that carries oxygenA tool used by doctors to listen to the heart and lungs...

The Creation Stories 2025-04-14

8 Items: ____ and EveThe ______ EThe GeneratorThe destroyerOn which day did god restThe big bang was 13.7 _______ Years agoGoing from a group of cells to a speciesThe Creator of the universe in Abrahamic religions

Biology Vocab- Cell Structure and Function 2025-11-12

54 Items: hollow tubegreen pigmentmakes proteins.interior of cellgroup of tissueslimits cell sizebasic unit of lifea chloroplast is onepart of the cytoplasmhouses the cell’s DNAcontains condensed DNAa semipermeable barriershort hairlike structureMovement without energy.same solute concentrationlower solute concentrationhigher solute concentration...

muscular system 2025-12-11

20 Items: Downbone to bonemuscle to boneenergy for musclesand under involuntary controlof muscle fibers wrapped in perimysiummuscle attaches to a more stationary bonemuscle attaches to the more movable bone.movement in opposite direction from musclefibers that are innervated by a single nervebody parts and assist prime movers, Helping Muscles...

COMPUTER ESSENTIALS 2019-09-24

80 Items: ROMRAMCPULANURLKEYRUNTABBIOSHTMLDATAWIFILINKSAVEICONMENUSPAMBLOGCOPYDRAGDROPROWSCACHEVIDEOMOUSEFILESVIRUSPASTECELLSLAPTOPFLOPPYSCREENCURSORSLIDESCAMERASERVERROUTERUPLOADDELETESEARCHFOLDERSCROLLFILTERDOMAINHEADERFOOTERBORDERMONITORSPEAKERPRINTERSCANNERBATTERYNETWORKINSTALLARCHIVEUPGRADESPYWARECORRUPTPODCASTWORDARTCOLUMNSCOMPUTERKEYBOARDFIREWALL...

Atom Word Search 2025-02-09

20 Items: The smallest unit of matterA group of atoms bonded togetherThe amount of mass in a given volumeThe process of liquid turning into gasThe force that pulls objects toward EarthRelating to the movement of Earth's crustThe bouncing back of light from a surfaceThe speed and direction of a moving objectThe process of gas turning back into liquid...

Test 2025-03-31

16 Items: – Too small to be seen with the naked eye.– The number of kingdoms in Domain Eukarya.– The material that makes up plant cell walls.– An organism that makes its own food, like algae.– The structure that holds DNA in eukaryotic cells.– A type of cell with a nucleus, found in Domain Eukarya.– An organism that must consume other organisms for food....

The Musculoskeletal System 2022-12-05

25 Items: the arms and legsbones in the palmmiddle of the boneword-root for necka type of bone cellbone-building cellsbone-breaking cellsthe ends of the bonessoftening of the skullword-root for vertebrathe Word-root for skullinflammation of the neckthe framework of the bodythe word root for fingersinflammation in the vertebrapain in the arm or upper arm...

The Musculoskeletal System 2022-12-06

25 Items: the arms and legsbones in the palmmiddle of the boneword-root for necka type of bone cellbone-building cellsbone-breaking cellsthe ends of the bonessoftening of the skullword-root for vertebrathe Word-root for skullinflammation of the neckthe framework of the bodythe word root for fingersinflammation in the vertebrapain in the arm or upper arm...

Semester Review 2025-05-20

28 Items: kneecapFormation of bone"Good" cholesterolOnly moveable skull boneDeep grooves in the brainMain site of gas exchangeGland that secretes earwaxTerm for too little oxygenA part of the thoracic cageLiquid element of the bloodNormal range is 70-15 mg/dLRupturing of red blood cellsUpper portion of the sternumkeeps food out of the trachea...

HYPER AND HYPO ! 2023-10-08

15 Items: LONGSIGHTEDNESSEXTREME WEAKNESSSHORTSIGHTEDNESSEXCESSIVE VOMITINGTHICKENING OF BONEDEFICIENT MUSCLE TONEEXCESSIVE PERSPIRATIONEXCESSIVE TALKATIVENESSEXCESSIVE SECRETION OF MILKDECREASES BLOOD SUGAR LEVELLOW POTASSIUM LEVEL IN BLOODDEFICIENCY OF SODIUM IN THE BLOODDECREASED AMOUNT OF OXYGEN IN THE TISSUE...

BioMid Review 2025-12-09

31 Items: the study of cellsthe study of cells2nd phase of mitosis1st phase of mitosis3rd phase of mitosis4th phase of mitosiscondensed threads of chromatinDNA to RNA; occurs in the nucleusDNA enables life through this criteriaorganelle responsible for protein synthesisRNA to protein; takes place inthe cytoplasm...

Fundamentals of Biology 2025-07-28

28 Items: The smallest unit of lifeThe smallest unit of matterThe building block of proteinsA building block of DNA and RNATwo or more atoms joined togetherA group of cells that work together.A package of DNA found in the nucleusA copy of DNA that helps make proteinsThe part of the cell that makes proteinsA substance made of two or more elements...

Space Word Search 2025-11-26

86 Items: cornseedmossfernrootSoildicoturbanWeedspestscellsfruittrunkshootwaterlupingrowthplantsginkgoforestseasonflowerantherstamenbranchoxygenstatchchillicarrotobliskconifermonocotwetlandesturaytussockcontrolglucosevacuolestomataharakekefruitinghabitatsnitrogenvariablecellwallmarigoldmisshallLifecyclekauritreesproutingliverwortecosystempotassiumnutrients...

7th grade Landon 2024-05-15

15 Items: waterenergypumps bloodbone in forearmfights infectionmakes plants greenholds the cells dnahow plants make food4 sections in the heartwhen water turns into a gasmakes up most of the atmospherelooks like cotton candy in the skythin walls that blood travels throughdeoxygenated blood travels through thistakes one minute to travel through the body

Lavin's Radiography for Veterinary Technicians Cp 3 2024-01-08

10 Items: Gamete-producing glandCell division in somatic cellsImaging modality that uses xraysConstructed to protect from radiationFormation of organs during developmentMeasure of ionization produced by xraysNational Council on Radiation ProtectionInstrument that detects ionizing radiationProbability of biologic response to radiation...

Cells Word Search 2023-11-06

2 Items: organelles, cytoplasm, vacuole, nucleus, ribosomes, organ, tissuecompound, carbohydrate, lipid, protein, enzyme, nucleic acid, double helix, organelles, proteins, lysosomes, chloroplast,

Year 7 - Vocabulary - Organs- Biology@EIS 2025-10-06

20 Items: Plant organPumps bloodControl systemContains brainPhotosysnthesisBottom of ThoraxContracts and relaxesRemoves waste productsPart of nervous systemGroup of similar cellsGroup of similar tissueThe body is divided intoPart of digestive systemPart of breathing systemPart of excretory systemContains Lungs and heartDevelopment of Offsprings...

Microbial Growth 2024-10-14

32 Items: Often used as an indicator of microbial growth.Nutrients required by organisms in small amounts.Nutrients required by organisms in large amounts.An organism that thrives at very low temperatures.Long-term interaction between two different species.Organisms that require oxygen for survival and growth....

Conifer Vocab II -- Forestry 2024-06-03

25 Items: The slender, pointed leaf of a coniferous tree.Small pores on plant surfaces, regulating gas exchange.The green pigment in plants responsible for photosynthesis.The inner, older wood of a tree, providing structural support.Trees that shed their leaves annually, in contrast to conifers.The protective outer covering of a tree, composed of dead cells....

Anatomy 2025-12-03

30 Items: Lying face up.Deoxyribonucleic acidThe inside of the bodyThe front of the body.The outer layer of the skin.Movement towards the midline.The scientific study of life.The middle layer of the skin.The largest organ of the body.Movement away from the midline.Turning a body part down or backward.Indicates a location closer to the head...

Module 1 intro to ecology Wordsearch 2023-09-19

8 Items: A singular organismSomething that is aliveAn organism composed of many cellsAn organism composed of only one cellMultiple of specific type of organismMultiple different types of organismsMany Organisms and their abiotic surroundingsA condition an organism has to maintain in order to survive

Case study on Charlie 2023-04-30

15 Items: type of formulaloss of body fluidloose watery stoolslab value to monitordifficulty swallowingcomplication from feedingabnormally low body weightcancer Past medical historycaused by not eating enoughfeeding type of tube feedingloss a reduction in body sizecancer treatment that kills cellssomething that you monitor with feeding...

The Nervous System :) 2024-02-21

15 Items: - the largest lobe of the brain- the sensory switchboard of the brain- part of the brain that controls breathing- part of the brain that coordinates movement- part of the brain in charge of memory and hearing- a disorder of the brain characterized by repeated seizures- part of the body that receives and sends sensory information...

Parts of a Cell Word Search- By Roylee Jones 2024-09-23

12 Items: The rough highway.The smooth highway.Tiny protein makers.Makes food using sunlight.The powerhouse of the cell.Barrier surrounding the cell.The control center of the cell.Breaks down waste and recycles.Jelly-like fluid inside the cell.The cells highway that transports.Storage bins that hold water and nutrients....

LAB WEEK 2023-04-04

75 Items: capptojclascpVEINedtaACIDsheaPEAKLISTPOORFLUIDURATESWABSPANELPANELWATERQUESTsysmexddimerVIOLETBUFFERsalinePLASMAosbornfrozenSILVERHEPARINCITRATECONTROLpotluckaliquotaliinitysafraninvitalantlineritybenefitssendoutsDONATIONCROSSINGGENEXPERTvaginosisreceivingsaniclothbiohazardRED CELLSplateletssulfolyzerfibrinogenneoplastinINVENRTORYcompetency...

Science Vocabulary 2023-03-28

20 Items: DNA has a double _______ shape.A cell without a nucleus. _____________________The powerhouse of the cell. _____________________The control center of the cell. _____________________Charles __________ is known as the Father of Evolution.In _____________________, DNA is converted to an RNA code....

Pathophysiology Word Search 2025-01-25

20 Items: The cause(s) of a diseaseHow the disease process evolvesThe physiology of altered healthA compilation of signs and symptomsThe functional effects of a diseasePresent at, and usually before, birthA manifestation that is noted by an observerThe death-producing characteristics of a diseaseAggravation of symptoms and severity of the disease...

Science Word Search 2023-03-01

19 Items: F=MxASpeeding upSlowing downsolar eclipselunar eclipselunar eclipsesolar eclipseA push or pullA unit for forcethe unit of energyThe amount of speedPower house of the cellthe earth orbits the...moon first lunar phasewhat holds the slide in placewhat you can use to see cellsThe direction the earth orbitshow many lunar phases are there...

Anime Shows 2022-11-21

57 Items: manendnotetailmoontaxiballcharaouranstonejojospieceeatergeassmaidennarutobleachknightyugiohbutlererasedrezerobasketperiodslayerkaisenclovertrigunaoashimagicapersonaat workhaikyuudurararaexorcistinuyashahellsingparasyteon titanbeastarsx hunterof kingschamploooverlordx familyneverlandof healerpunch manrevengersmegaloboxart onlinestray dogspsycho 100...

Skin Disorders 2025-11-03

23 Items: A mark on the skinDistended/dilated blood vesselsKeratin filled cysts around the eyesLarge blister containing watery fluidBrown or flesh colored skin outgrowthChronic inflammation of sebaceous glandsA sore produced by scratching or scrapingCongenital absence of melanin in the bodyThin dry or oily plate of epidermal flaking...

Skin care 2024-10-30

30 Items: boilWartpimplespink eyeswellingbirth markbeauty markchicken poxlack of pigmentpersistent itchingmedical practitionerpore clogging ingredientsover production of pigmentdarkened shade of the skinfoul-smelling perspirationabnormal growth of the skina permanent mark on the bodyredness caused by inflammationa small sac or blister filled with liquid...

6th Frye List 2025-08-22

98 Items: joblaysatskysumarmsbillbluecantdropedgeeggsfeltgoneheldkeptlegslovemainmeetmindmoonpastracerainrootsignsitesofttestwallwestwidewildwishcausecellsdancedrivegrasshappyheartpaintreadyshallstorethirdtrainbesidecenterenergyEuropeforestlengthmattermonthspickedraisedreasonrecordregionreturnsimplesquaresummerwindowwinterbelievebrotherclothesdividedfarmers...

Cardiovascular and Lymphatic Systems 2024-12-17

20 Items: transports oxygencontains hemoglobinpumps blood and oxygenfights against infectionThe top chambers of the heartthe lower chambers of the hearta microorganism that causes diseasethe oxygen-carrying protein in bloodvessel that returns blood to the heartclear fluid that fills the spaces around body cells...

The Respiratory System 2024-04-24

12 Items: What we breath outHas 12 paired bonesThe smallest airwayOften called the windwipeWhere you breath in and outAllowes our cells to breath.Major muscle of respiratory systemSomething at the end of bronchiolesA large airway leading from windwipeSomething that always you too breathBlood vessels that exist through out your body...

Organelles 2025-11-17

15 Items: Makes proteinsSite of photosynthesisHelps with cell divisionSmooth; synthesizes lipidsProduces energy for the cellStores water, nutrients, or wasteBreaks down waste and old cell partsContains the cell’s genetic materialcalled the "Control Center" of the cellControls what enters and leaves the cellFound inside the nucleus; makes ribosomes...

Photosynthesis & Cellular Respiration 2023-02-27

4 Items: process plants use to make energythe sugar made by plants during photosynthesisthe green pigment in plants where chloroplasts are foundthe name of the energy molecule used by cells is ---- tri phosphate

Homeostasis 2024-11-28

11 Items: a chemical messengera change in the environmentmuscles or glands, make changesthe control of blood water levelsthe control of blood glucose levelswhat enzymes do in high temperaturesthe control of internal body temperaturecells that detect a change in environmentdetect, correct (HORMONE), back to normalthe organ with the highest glucose consumption...

Characteristics of Life 2024-11-15

12 Items: Any living thingAn organisms genetic codeMade of more than one cellChange in a species over timeBacteria are this type of cellAn organism increasing in sizeProkaryotic cells do not have thisChanges in an organisms environmentMaintaining stable internal conditionsAn organism that can make its own foodChanges in an organism over its lifetime...