cells Word Searches

Energy changes and cells key terms 2019-02-14

20 Items: CellHeatEnergyProductProfileMitosisMeiosisNucleusReactantReactionActivationExothermicEukaryoticMicroscopeEndothermicPolystyreneTemperatureThermometerProkaryoticMitochondria

Classifying Organisms 2023-11-03

11 Items: - cells have a nucleus- made up of many cells- made up of many cells- cells do NOT have a nucleus- must eat other organisms for food- the scientific study of classification- can make its own food using energy from the sun- grouping things together based on similar characteristicsnomenclature - the two-part naming system for naming organisms...

Anatomy Vocabulary  2014-10-19

37 Items: bonecilialumenloosedensecellsSimpleapicalmatrixfiberssurfaceareolaradiposeelastichyalinesquamouscuboidalcolumnaravascularreticularEpithelialstratifieddesmosomesmicrovilliorganellescartilage.gapjunctionspecializedtransitionaldenseregulartightjunctiondenseirregularfibrocartilagebasementmembranepseudostratifiedconnectivetissuesconnectivetissueproper

LABORATORY 2014-04-13

38 Items: reddrugstaturinestoolmicroserumcellsbloodcellsfreshslidesbiopsyplasmaglovessharpsfrozenaliquothryciukrainbowpipettescreensculturespadureanreagentscytologyanalyzerpathologyhistologyspecimenschemistrybiohazardgozdowiakhemolysisscientistcentrifugeglucometercoagulation

Classifying Organisms word search. 2023-10-20

11 Items: - made up of one cell- cells have a nucleus- made up of many cells- cells do NOT have a nucleus- must eat other organisms for food- the scientific study of classification- can make its own food using energy from the sun- the two-part naming system for naming organisms- grouping things together based on similar characteristics...

Unicellular Word Search 2023-11-04

11 Items: - made up of one cell- cells have a nucleus- made up of many cells- cells do NOT have a nucleus- must eat other organisms for food- the scientific study of classification- can make its own food using energy from the sun- grouping things together based on similar characteristicsnomenclature - the two-part naming system for naming organisms...

Human Anatomy Words # 32 2024-03-30

40 Items: skinulnabonescellsbrainheartlungsliverskullfemurtibiaveinsorgansorgansjointspelvisradiusmusclestissueskidneysstomachbladdernervoustendonsribcagehumerusskeletonpancreascartilageligamentsvertebraespinalcordintestinesrespiratorepithelialgallbladdercirculatoryreproductiveimmunesystemnervoussystem

CHEMICAL COMPOUNDS IN CELLS 2023-03-23

10 Items: dnawaterlipidsenzymeproteinelementcompoundsnucleicaciddoublehelixcarbohydrate

Energy changes and cells key words 2019-02-14

20 Items: CellHeatEnergyProductProfileMitosisMeiosisNucleusReactantReactionActivationExothermicEukaryoticMicroscopeEndothermicPolystyreneTemperatureThermometerProkaryoticMitochondria

Epithelial and Root Hair Cells 2024-03-27

12 Items: rootsizewatershapeabsorbvacuolesensoryfunctionepithelialadaptationmitochondriaspecification

lab week 2 2016-09-01

40 Items: AGARFLASKSLIDESCALECELLSBLOODASSAYBENCHLYSISTITERBEAKERPLASMACERNERBUFFERENZYMECORELABALIQUOTCONTROLLIPEMIAICTERICREAGENTTESTTUBEPOSITIVECHEMISTRYBLOODBANKPLATELETSCALIBRATEPRECISIONMICROSCOPEHEMATOLOGYCENTRIFUGEIMMUNOLOGYMONOCLONALTHERMOMETERSENSITIVITYBUNSENBURNERMICROBIOLOGYSAFETYGOGGLESANTICOAGULANTGRADUATEDCYLINDER

Anatomy Word Search 2023-09-19

40 Items: eyesskinbloodbraincellsliverlungsopticveinsatriumlarynxorgansspleensystemanatomybladderchambercraniumdiseaseenzymeskidneysnervousstomachtissuesurinaryarteriesmuscularskeletaldigestiveendocrinenutritionventricleintestineslymphnodesphysiologycapillariescirculatorygallbladderrespiratoryreproductive

Words of Biology 2022-10-12

35 Items: acidacidcellcellsacidsatomslipidscarbonoxygenbiologyenzymesstimuliglucosenucleusgenotypeproteinshydrogenmonomerspolymersribosomemembranephenotypefragmentsorganismsglutaminemicroscopeorganelleschromosomesobservationenvironmentbiochemistrybiomoleculesmitochondriacarbohydratestriacylglycerol

pe 2023-05-18

35 Items: cellsspinediscsbonesdiscslungsbloodveinslimbsjointsjointsstraincavityoxygennervestissuetissueposturemusclesblockedbackbonemovementartiriesskeletonsquashescompressnumbnessswellingexistencebloodflowligamentsoverworkssignalingpresurerizesskeleton muscles

Week 3 Review by Sharli Syed 2023-11-05

11 Items: Makes proteinsBreaks down food into energyInformation for making proteinsPackages and sends proteins out of the cellContains and protects genetic material (DNA)Breaks down and recycles worn out animal cellsCellular package containing products such as proteinHolds everything inside the cell, enclosed by the cell membrane...

Cell Organelles 2022-10-06

29 Items: the DNA of a prokaryotethe carrier of genetic informaciĆ³nhelps in the storage of proteins and lipids.An organelle that helps sequester waste productsynthesizes and stores proteins, bound with ribosomesthe basic unit of life in organisms of the kingdom Plantae.the basic unit of life in organisms of the kingdom Animalia....

Autism Mix  2016-02-24

43 Items: ShySeeAgeHairCareHumorBraveWittyCellsAutismNoisesLightsVerbalUniqueVisualStrongSensesSocialLonelyAmazingCuriousLimitedAnxietyPuzzledBulliedJoblessRoutinesCreativeAttitudeTalentedDisorderAspergerFriendlyPatternsTreatmentNonverbalIsolationAbilitiesDifferentRepetitionMysteriousDifficultyCommunication

Ch. 13 Medical Terminology Word Search 2024-01-26

5 Items: red blood cellsabnormally swollen veinsdangerous infection of the blooda drug that prevents clotting of the bloodincreased number of red blood cells in blood

Human Body Systems 2023-05-08

11 Items: provides movementsends messages as hormonestransports blood through bodyprotects the body from diseasebreak down and absorbs nutrientsfilters blood and excretes wastemakes hormones, egg and sperm cellstransports oxygen and carbon dioxideprovides structure, makes blood cellsfancy system name for the skin, hair, nails...

Laboratory Word find 2023-07-25

46 Items: hodswaburinestoolbloodcellsunitsglovesplasmasharpsfrozenslidesbiopsybeakersafetytissuepipetterackingaliquotculturescreenssyringecorelabpathwayculturescytologyantibodyanalyzerchemistrypathologyhistologyhemolyzedbiohazardpathologybloodbankcentrifugeglucometerhematologylaboratorymicroscopeurinalysisphlebotomycoagulationmicrobiologysupportservices...

Body Parts 1: Cells & DNA 2014-02-12

12 Items: EnzymesAdenineThymineGuanineOrganismCytosineMiescherHeredityGeneticsMoleculesChromosomesNeucleotides

Biology 2023-05-18

44 Items: nicdnacolezachericbryanissacgreenmyattjacobjulielancescottcellsfrogselliotjustingibsontaylormcpeakmorriskinseyquallsfunfunballardbartelsboultonraymondrideoutsanderslambertbiologybrambachchandlerrainlynnwilliamschristianrodriguezwedgewoodpondwatermicroscopedissectionorganellesphotosynthesis

Blood Word Search 2017-10-05

49 Items: ABOdosepainpumpratetimetypeunitbloodcellsfeverfreshlabelnurseorderpulseserumshockwholeaccesschillsfilterfrozenplasmasalinetubingverifyconsentcatheterdirecteddocumentheadacheinfusionnegativepositivereactionhemolyticleucocyteplateletsautologouscrossmatchhemaglobininfiltrateirradiatedintravenousanaphylaxsispolycythemiaadministrationdiphenylhydramine

Microsoft Vocabulary 2016-12-06

49 Items: asatboxnewrowsavetabswordwrapreadmodefindbarszoomcopyboldcelltextprintsplitleasttablemergecellsgroupsribbondialogwindowscrollitalicindentsinglereplacewordartspacingexactlymarginscolumnssettingstemplatemultipleportraitthumbnailclipboardcharacterlandscapesuperscriptorientationautocomplete

aids/hiv 2023-02-15

17 Items: nocurecausebyvirusattackst-cellabstinenceiskeyweakimmunesystem.hivcanturnintoaidstcellsaredestroyedspreads to a newbornkills if not treatedlowweightinnewbabieshavingsexcanspreadthisbrestfeedingcanspreadthissharingneedlescanspreadthisoneofsymptomswellinglymphglandscontactwithinfectedbloodcanspreadthisaidsisachronicpotentiallylife-threatening...

Word Cells List ONE Word Search 2022-10-04

10 Items: yerlybiogeosubishauduniphon

Oncology Word Search 2023-05-02

14 Items: study of cancertumor of the kidneysdonation from anothercare to mitigate sufferingarises from embryonal cellsdecrease in white blood cellscreate unchecked cellular growthtumors arising from muscle tissuenonpharmacological therapy for nauseais more common if neutrophils are < 500Lymphoma with painless, rubbery lymph nodes...

Vocabulary Review 2016-04-11

55 Items: SUNWEBPREYFOODFOODMASSMOSSSOILFOODCELLQUIZWATERCHAINTOXICCELLSFUNGIWATERBIOMEGRAPHSTUDYCARBONENERGYMATTERPLANTSLICHENPYRAMIDBIOMASSMAMMALSVACUOLEHABITATNITROGENCONSUMERPREDATOROMNIVOREPRODUCERBACTERIAVASCULARMEMBRANEDIVISIONHERBIVORECARNIVOREAUTOTROPHECOSYSTEMPERMEABLEVERTEBRATEHETEROTROPHNONVASCULARSELECTIVELYCOMPETITIONPOPULATIONSINVERTEBRATE...

Esthetics: 105 Anatomy & Physiology A 2024-04-17

53 Items: skincellsorganbrainheartlungsliverbonesveinstissuesystemkidneyspleenanatomynucleusmitosismeiosisstomachovariesribosomearteriespancreashistologypathologycytoplasmcentrioleanabolismintestinephysiologymetabolismprotoplasmchromosomecatabolismnervetissuecapillariesgrossanatomycellmembranemitochondriacardiacmusclenervoussystemmusculartissueskeletalsystem...

Immunology Word Search 2024-03-13

15 Items: Immunoglobulin producing cellsProtein encoded by HIV gag geneGold standard test for screening SLECells responding to parasitic infectionsSarcoma associated with HHV-8 infectionsAntibody is in excess compared to antigenMost abundant immunoglobulin in adult serumRegion of immunoglobulin that binds antigensMediator of Type I hypersensitivity reactions...

Ginormous! Cells and Organelles word search 2015-09-09

10 Items: cellacidAnimalcaringcellulosereticulumchloroplastcitizenshipendoplasmicdeoxyribonucleic

Animal and plant cells 2022-11-15

6 Items: catlionzebrahippoelephantMan's best friend

ITS ALL ABOUT MICROSCOPIC LIFE 2024-03-01

22 Items: The powerhouse of the cellSingle Celled microorganismsone-celled aquatic organismsGreen pigment in plants and algaea substance capable of causing cancersmallest unit that can live on its ownMaterial within a living cell-jelly-likeSmall common fly found near rotted fruitViruses that infect and replicate in cells...

General Science 2024-04-03

59 Items: gaslakecellatommassmeltcellsbonesrocksoceanorgangenesforcespeedcloudsystemtraitsenergyfreezebiologygeologynucleusproteinalleleselementgravitykineticmineralssedimentmembraneribosomegeneticsdominantmoleculeparticlehydrogenchemistrydigestivecytoplasmrecessivepotentialscientistexperimenthypothesisorganelleschromosomemechanicaldepositionrespiratory...

WORD HUNT 2014-08-23

60 Items: LIFEGENESMOKELIGHTBLOODLUNGSCELLSVEINSWATERHEARTPLASMAENERGYASTHMASTROKESTROMAMENDELGRANUMOXYGENDIPLOIDALLELESALVEOLIEXTINCTSPECIESBRONCHIHABITATHAPLOIDHEREDITYDINASOURACIDRAINDOMINANTLEUKEMIASUNLIGHTGENOTYPEOILSPILLDIAPHRAGMPOLLUTIONKARYOTYPEKREBSCYCLEENDANGEREDTHAKALOIDSGLYCOLYSISVULNERABLEPYRUVICACIDCALVINCYCLECHROMOSOMESCODOMINANCEINSECTICIDES...

this will kill more brain cells than the state test 2023-12-08

250 Items: adaeafagaceacmactadaaddadsageavebadableaceracidacneacreactsadamaddsadslagedautoawaybabebabybackaaronaboutaboveacidsacresactoracuteadamsaddedadminadmitadobeadoptadultafteragainagentautosavoidawardawarebabesbaconabroadabsentaccentacceptaccessacrossactingactionactiveactorsactualaddingadidasadipexadjustadrianadultsadvertadviceadviseadwareaerialaffair...

Life Science 2023-06-12

63 Items: dnaatomgenepreycellsclaimplantanimalbiomesdarwinfossilsafetyelementfoodwebmeiosismitosisnucleusosmosisproteincompoundconsumerdominantecosytemevidencegeneticsomnivoreorganismpredatorproducercarnivorecommunitydiffusionevolutionherbivorelabskillsreasoningrecessiveadaptationeukaryoticmicroscopepopulationwatercyclecarboncyclechloroplastnucleicacid...

Microgravity Effects Word Search 2023-05-30

57 Items: masslossnasafloatspacebloodswellnerveheartcellsfluidsmuscleweakenshrinkstraincanalsorgansmotionhealthrhythmmakinggravityeffectsatrophybrittlecalciumbalancesensoryotolithelectricmagneticexposurepressureregulatemineralsmovementresponsescheduleradiationdestroyerdizzinessunbalanceisolationdemandingweightlessastronautsspacecraftatmospherevestibular...

Medical Term Ch 2 2024-01-17

16 Items: Out ofWithinControlThe study ofA specialistGrowth or formationThe study of diseaseCondition produced by diseaseCommonly known as belly button or navelA disease producing microorganism such as a virusProvides protective padding, insulation, and supportThe basic structural and functional units of the body...

this will kill more brain cells than the state test 2023-12-08

250 Items: adaeafagaceacmactadaaddadsageavebadableaceracidacneacreactsadamaddsadslagedautoawaybabebabybackaaronaboutaboveacidsacresactoracuteadamsaddedadminadmitadobeadoptadultafteragainagentautosavoidawardawarebabesbaconabroadabsentaccentacceptaccessacrossactingactionactiveactorsactualaddingadidasadipexadjustadrianadultsadvertadviceadviseadwareaerialaffair...

Word Search Key Terms 2024-03-05

52 Items: ldlhdltactrategaitsignssignspulsesmellclearcolortriageplasmareflexmemoryvisionborderhistoryempathyfactorshormonehearingstridorrhonchisymptomsdemeanorpressuremovementstrengthresponsewheezingcracklesdiameterevolvingdiagnosiscomplaintleukocyteplateletssensationasymmetrymass indexhemoglobinhematocritmetabolismhomeostasiserythrocytethrombocyte...

Year 8 Plant and Animal Cells Wordsearch 2023-11-23

9 Items: cellplantanimalnucleusvacuolecellwallcytoplasmcellmembranechloroplasts

Sciences of the World: Gmo's and Cells! 2016-02-21

10 Items: GRASGenomeGeneSplicingModificationBiotechnologyCrossBreedingrecombinantDNASelectivebreedingGeneticengineeringGeneticallyModifiedFood

Cell Organelles 2023-09-12

14 Items: Two organelles that work to help the cell divide.Storage bins where food, nutrients, or waste are kept.Sphere shape in the nucleus. Makes ribosomes for the ER.Flexible material that holds the parts of the cell together.The brain of the cell that controls eating, movement, and reproduction....

this will kill more brain cells than the state test 2023-12-08

250 Items: adaeafagaceacmactadaaddadsageavebadableaceracidacneacreactsadamaddsadslagedautoawaybabebabybackaaronaboutaboveacidsacresactoracuteadamsaddedadminadmitadobeadoptadultafteragainagentautosavoidawardawarebabesbaconabroadabsentaccentacceptaccessacrossactingactionactiveactorsactualaddingadidasadipexadjustadrianadultsadvertadviceadviseadwareaerialaffair...

this will kill more brain cells than the state test 2023-12-08

250 Items: adaeafagaceacmactadaaddadsageavebadableaceracidacneacreactsadamaddsadslagedautoawaybabebabybackaaronaboutaboveacidsacresactoracuteadamsaddedadminadmitadobeadoptadultafteragainagentautosavoidawardawarebabesbaconabroadabsentaccentacceptaccessacrossactingactionactiveactorsactualaddingadidasadipexadjustadrianadultsadvertadviceadviseadwareaerialaffair...

1 2023-06-04

71 Items: maxnemoelliselisanadiajamesaleahlucascellsgenespolarchainspeedsophiahayleejaidynaudreyhunterfinleymaddeytraitsmattercirrusbiomesforcessciencenimbrodcharlienervouscumulusstratusclimateweatherestuarygravityinertiafranklinbrooklynmachealajeremiahheredityskeletalmuscularpressuretropicalhumiditymomentumfrictionelizabethdigestiveradiationinsulator...

potassium b-day 2023-02-14

69 Items: rsccoolnsaayarnswaghipzamarsmartchillcellsalicegracecaringtanniscyroneplayfulkittiesbiologycrochetshoebopactivismlearningknittingdairydomganglandcellularunclularbabayagacellomanpotassiumisoscelescashformecelloularbenevolentthoughtfulashmaezingmoneyformeunclerogerjazzydaddyveinyhandsbutisbobbobsuperclassybillionaireeasanibcaadwordoftheday...

Sophia Word Search 2023-06-03

71 Items: maxnemoelliselisanadiajamesaleahlucascellsgenespolarchainspeedsophiahayleejaidynaudreyhunterfinleymaddeytraitsmattercirrusbiomesforcessciencenimbrodcharlienervouscumulusstratusclimateweatherestuarygravityinertiafranklinbrooklynmachealajeremiahheredityskeletalmuscularpressuretropicalhumiditymomentumfrictionelizabethdigestiveradiationinsulator...

nvrt 2023-10-18

21 Items: polyppermianjurassicphasmidsflagella"false feet"reef-buildingtapeworm headhermaphroditic_________ oozeā€œlittle kidneysā€having separate sexes_____________ explosionnematode glandular systemsegments in cestodeā€™s bodyfree-living flatworms (Class)ā€œbell formā€ cnidarian body planalgal symbionts of coelenteratesanterior chemosensory organ of nematodes...

COMPUTER ESSENTIALS 2019-09-24

80 Items: ROMRAMCPULANURLKEYRUNTABBIOSHTMLDATAWIFILINKSAVEICONMENUSPAMBLOGCOPYDRAGDROPROWSCACHEVIDEOMOUSEFILESVIRUSPASTECELLSLAPTOPFLOPPYSCREENCURSORSLIDESCAMERASERVERROUTERUPLOADDELETESEARCHFOLDERSCROLLFILTERDOMAINHEADERFOOTERBORDERMONITORSPEAKERPRINTERSCANNERBATTERYNETWORKINSTALLARCHIVEUPGRADESPYWARECORRUPTPODCASTWORDARTCOLUMNSCOMPUTERKEYBOARDFIREWALL...

HYPER AND HYPO ! 2023-10-08

15 Items: LONGSIGHTEDNESSEXTREME WEAKNESSSHORTSIGHTEDNESSEXCESSIVE VOMITINGTHICKENING OF BONEDEFICIENT MUSCLE TONEEXCESSIVE PERSPIRATIONEXCESSIVE TALKATIVENESSEXCESSIVE SECRETION OF MILKDECREASES BLOOD SUGAR LEVELLOW POTASSIUM LEVEL IN BLOODDEFICIENCY OF SODIUM IN THE BLOODDECREASED AMOUNT OF OXYGEN IN THE TISSUE...

The Musculoskeletal System 2022-12-05

25 Items: the arms and legsbones in the palmmiddle of the boneword-root for necka type of bone cellbone-building cellsbone-breaking cellsthe ends of the bonessoftening of the skullword-root for vertebrathe Word-root for skullinflammation of the neckthe framework of the bodythe word root for fingersinflammation in the vertebrapain in the arm or upper arm...

The Musculoskeletal System 2022-12-06

25 Items: the arms and legsbones in the palmmiddle of the boneword-root for necka type of bone cellbone-building cellsbone-breaking cellsthe ends of the bonessoftening of the skullword-root for vertebrathe Word-root for skullinflammation of the neckthe framework of the bodythe word root for fingersinflammation in the vertebrapain in the arm or upper arm...

Lavin's Radiography for Veterinary Technicians Cp 3 2024-01-08

10 Items: Gamete-producing glandCell division in somatic cellsImaging modality that uses xraysConstructed to protect from radiationFormation of organs during developmentMeasure of ionization produced by xraysNational Council on Radiation ProtectionInstrument that detects ionizing radiationProbability of biologic response to radiation...

Module 1 intro to ecology Wordsearch 2023-09-19

8 Items: A singular organismSomething that is aliveAn organism composed of many cellsAn organism composed of only one cellMultiple of specific type of organismMultiple different types of organismsMany Organisms and their abiotic surroundingsA condition an organism has to maintain in order to survive

Case study on Charlie 2023-04-30

15 Items: type of formulaloss of body fluidloose watery stoolslab value to monitordifficulty swallowingcomplication from feedingabnormally low body weightcancer Past medical historycaused by not eating enoughfeeding type of tube feedingloss a reduction in body sizecancer treatment that kills cellssomething that you monitor with feeding...

Cells Word Search 2023-11-06

2 Items: organelles, cytoplasm, vacuole, nucleus, ribosomes, organ, tissuecompound, carbohydrate, lipid, protein, enzyme, nucleic acid, double helix, organelles, proteins, lysosomes, chloroplast,

The Nervous System :) 2024-02-21

15 Items: - the largest lobe of the brain- the sensory switchboard of the brain- part of the brain that controls breathing- part of the brain that coordinates movement- part of the brain in charge of memory and hearing- a disorder of the brain characterized by repeated seizures- part of the body that receives and sends sensory information...

Anime Shows 2022-11-21

57 Items: manendnotetailmoontaxiballcharaouranstonejojospieceeatergeassmaidennarutobleachknightyugiohbutlererasedrezerobasketperiodslayerkaisenclovertrigunaoashimagicapersonaat workhaikyuudurararaexorcistinuyashahellsingparasyteon titanbeastarsx hunterof kingschamploooverlordx familyneverlandof healerpunch manrevengersmegaloboxart onlinestray dogspsycho 100...

LAB WEEK 2023-04-04

75 Items: capptojclascpVEINedtaACIDsheaPEAKLISTPOORFLUIDURATESWABSPANELPANELWATERQUESTsysmexddimerVIOLETBUFFERsalinePLASMAosbornfrozenSILVERHEPARINCITRATECONTROLpotluckaliquotaliinitysafraninvitalantlineritybenefitssendoutsDONATIONCROSSINGGENEXPERTvaginosisreceivingsaniclothbiohazardRED CELLSplateletssulfolyzerfibrinogenneoplastinINVENRTORYcompetency...

Science Word Search 2023-03-01

19 Items: F=MxASpeeding upSlowing downsolar eclipselunar eclipselunar eclipsesolar eclipseA push or pullA unit for forcethe unit of energyThe amount of speedPower house of the cellthe earth orbits the...moon first lunar phasewhat holds the slide in placewhat you can use to see cellsThe direction the earth orbitshow many lunar phases are there...

Science Vocabulary 2023-03-28

20 Items: DNA has a double _______ shape.A cell without a nucleus. _____________________The powerhouse of the cell. _____________________The control center of the cell. _____________________Charles __________ is known as the Father of Evolution.In _____________________, DNA is converted to an RNA code....

Photosynthesis & Cellular Respiration 2023-02-27

4 Items: process plants use to make energythe sugar made by plants during photosynthesisthe green pigment in plants where chloroplasts are foundthe name of the energy molecule used by cells is ---- tri phosphate

The Respiratory System 2024-04-24

12 Items: What we breath outHas 12 paired bonesThe smallest airwayOften called the windwipeWhere you breath in and outAllowes our cells to breath.Major muscle of respiratory systemSomething at the end of bronchiolesA large airway leading from windwipeSomething that always you too breathBlood vessels that exist through out your body...

Science Review Word Search 2023-03-02

17 Items: F=MxAspeeding upslowing downa push or a pullfirst lunar phasethe unit for forcethe unit for energythe amount of speedthe earth orbits the...the power house of the cellwhat you can use to see cellswhat holds the slide in placethe direction the earth orbitshow many lunar phases are therethe color of the moon during a lunar eclipse...

Chapter 10 Laboratory Procedures 2024-04-16

14 Items: after eatingaka fasted or before eatingcontains RBCs WBCs and plateletsmultiple samples can be collectedno anticoagulent, blood is clottedserum is cloudy or white, high in fatused for morphology, lavender top tubeused for blood chemistry, green top tubeno anticoagulent, layer to separate serumAKA microhematocrit, percentage RBC in blood...

Human and Social Biology 2022-12-09

22 Items: Gas to SolidSolid to GasLiquid to GasGas to LiquidLiquid to solidSolid to liquidTightly compactedMovement of WATERSlightly sepraratedNeeded for photosynthesiscollection of different cellsFewer molecules and separatedThe shape of the red blood cell.collection of different tissues.Form tissues that line the body cavities....

KVCS Zoology Week 1 Vocab Quiz 2023-09-02

20 Items: The study of plantsPlants that live for two yearsPlants that grow year after yearPlants that live for only one yeartype of adjective that modifies nounsFlowers that have both stamens and carpelsTakes the place of common and proper nounsA mature ovary that contains a seed or seedsFlowers that have either stamens or carpels, but not both...

Cnidarians Word Search 2024-01-29

20 Items: Having a diet consisting of other animals.The ability of cnidarians to regrow lost body parts.Stinging organelles within cnidocytes, injecting toxins into prey.The union of egg and sperm outside the body, common in many cnidarians.Symmetry around a central point, a characteristic feature of cnidarians....

Health Intro Vocab 2022-09-06

10 Items: Small DNA containing unitsTissue that enables muscles to moveThe study of the structure of the bodyThe study of how the structures functionspecific parts of the body with specific functionsTissue that maintains the shape and form of the bodyThe body's ability to maintain a balance needed to survive...

Nutrition 2022-12-13

35 Items: Blood sugarFruit sugarStart of digestionIndigestible starchComplex carbohydratesVitamins and MineralsGetting enough to eatPre-cursor to Vitamin ACarbs, fat, and proteinOne of the macronutrientsNeeded for blood clottingBuilding blocks of proteinIron found in animal foodsVitamin B12 is stored hereNatural source of Vitamin D...

Endocrine System 2022-08-04

20 Items: also know as alpha cellThyroid gland secretes itparathyroid gland targetsparathyroid gland producesThyroid gland also make thisanother name for insulin cellsanother hormone found in thymushyposecretion of growth hormonepromotes sodium & water retentionthis hormone is for tissue growthantagonist of the parathyroid gland...

Lipids Word Search 2023-08-14

10 Items: Source of energy, including sugars and starches.Fats and oils that store energy in living organisms.Short chain of amino acids, a component of proteins.Large molecules made by linking smaller repeating units.Breaking down molecules with water, often for digestion.Small molecule that can link together to form a polymer....

Parasitism Word Search 2023-03-24

9 Items: Symbiotic relationship in which both organisms benefitThe ____ system allows you to respond to your environment.The _____ system is responsible for making your body move.The _____ endocrine system regulates your body with different hormones.Symbiotic relationship in which one organism benefits, and the other is harmed...

Salon Skin Care 2023-07-10

20 Items: Foul-smelling perspirationCapable of destroying fungiA large blister containing clear, watery fluidThe study of muscles - their structure, function and diseasesAny material that allows or supports the flow of electric currentSmall, red elevated protrusion of the skin, usually containing no pus...

Vocabulary for Test 2023-05-16

25 Items: an egg or sperma form of a genea fertilized eggrequires one parentpart of a chromosomethe inherited allelessperm and egg combinethe study of geneticsa difference in a traita family tree for a traitan inherited characteristica change to genetic materiala type of asexual reproductionthe process that makes body cellsstructure made of DNA and protein...

M3 Parts of a Flower 2023-09-04

14 Items: the male gamete of a flower.Tough outer coat of the seed.Sweet, sugary fluid found in flowers.Part of the flower that stores pollen.Type of organ flowers are to the plant.Colorful part to attract insects and birds.Part of the flower that holds up the anther.The place where the male and female games fuse....

Blood Vessels 2023-05-05

6 Items: largest artery in the bodysmall arteries that deliver blood to capillariessmall veins that connect the capillaries to the veinsthick-walled, muscular, flexible tubes that carry oxygenated blood away from the heart to the arterioles...

Water 2023-05-24

29 Items: Xylem or phloemNegatively charged ionPositively charged ionlow enough for ice to floatAllows water to form its bondsPolar and ionic molecules; asymmetricalReaction where water molecule is releasedBonds where two non metals share an electronNon-polar and non-ionic molecules; symmetricalwater sticks to itself; the same as surface tension...

Science Word Search 2023-05-25

25 Items: The ability to dissolveThe harmful rays that come from the sunAn animal that hunts and eats other animalsA scale that shows the acidity of substancesThe SI base unit of thermodynamic temperatureThe type of cloud that tells you a storm is comingWhen different species work together, BOTH benefitThe layer of the atmosphere where weather occurs in...

CNA Review 2023-08-31

30 Items: to widenfaintingto urinateChest painheart muscledeath of tissuelow blood sugarhappens suddenlycapable of walkinga patient advocatethe act of vomitingdifficulty swallowingcentral nervous systemthe absence of breathingproduced by the pancreasperipheral nervous systemtemperature taken at the earsystolic bp greater then 130...

Variation 2023-05-18

20 Items: A random change in DNAThe variable you changeThe variable you measureThe organelle that contains DNAThe variables you keep the sameA different form of the same geneThe technique used to photograph DNAA result that does not fit the patternCharacteristics we get when we are bornThe change in species over millions of years...

Week 11 hard 2023-11-08

23 Items: winnerto worryurge to vomitfeeling relaxedthe guilty personable to do somethinga main branch of a treea false or mistaken ideathe removal of somethinglover of mankind; doer of goodwanting to know more about thingsthe season between summer and winterouter covering or sleeve for a letterthe hardest mineral on the Moh's scale...

Week 11 easy 2023-11-08

24 Items: winnerto worryurge to vomitfeeling relaxedthe guilty personable to do somethinginventive, imaginativea main branch of a treea false or mistaken ideathe removal of somethinglover of mankind; doer of goodwanting to know more about thingsthe season between summer and winterouter covering or sleeve for a letterthe hardest mineral on the Moh's scale...

jajshajjsjs 2023-05-31

10 Items: Pairs with thymineOrganic compounds used to store energyIn the double helix pairs with cytosineConverts the instructional genetic information stored in deoxyribonucleic acidEach nucleic acid has this, a 5-carbon sugar as a part of its polymer backbonePortion of the DNA double helix that provides structural support to the molecule....

a seach 2024-01-26

13 Items: Definition Audioand Definitions TableRenewable energy generated from heat within the earth.A pipe that feeds into a turbine within a hydropower dam.The movement of materials due to differences in temperature.Photovoltaic cells that turn sunlight directly into electricity.A fuel that is made from living matter. Includes ethanol and biodiesel....

Cord Blood Awareness Month - July 2023 2023-06-16

1 Item: Blood, Banking, Umbilical, Stem, Cells, Awareness, July, Safeguard, Hope, Future, Protect, Baby, Diseases, StemCord

Milady Anatomy & Physiology : Glands 2023-06-21

11 Items: Most complex organ of the endocrine systemPlays a major role in sexual development, sleep, and metabolismFunction in sexual reproduction as well as determining male and female characteristicsFunction in sexual reproduction as well as determining male and female characteristics...

Clay's Vocab 2023-09-26

23 Items: made a choiceto show clearlycontaining nothingyoung cows or bullsa quantity of somethingto form a mental pictureto total numbers togetherreflection of sound wavesa way to get into somethinga value that does not changea breaking of a law or promisedownward measurement from a surfacea sweet, brown food that is made from cocoa...

Chp. 3 Review for final 2022-12-13

23 Items: one layercolumn shapedmultiple layersanchoring junctionscube shaped like a diceflattened and fish scalebinds cells together like a zippermoves materials across the surfacevoluntary and striations and multinucleatefunction is to protect and support the bodyinvoluntary and no striations and one nucleus...

Chp. 3 Review for final 2022-12-13

23 Items: one layercolumn shapedmultiple layersanchoring junctionscube shaped like a diceflattened and fish scalebinds cells together like a zippermoves materials across the surfacevoluntary and striations and multinucleatefunction is to protect and support the bodyinvoluntary and no striations and one nucleus...

Module1: Introduction to pathology/Skeletal system 2023-12-20

18 Items: The primary site of ossificationThe most common form of arthritisA generalized decrease in cell sizeA generalized increase in cell sizeHaving more than one illness at the same timeAn abnormal change occurring in mature cells.The forward slippage of one vertebra on anotherA specific cancellous bone located in the skull...

Gardner Denver Thomas 2023-08-25

12 Items: Asian facilityEurope facilityNorthern North America facilitySouthern North America facilitypump units that are as small as a coin or a paper clipthe first choice for moving demanding fluids gently without any system downtimesolution pump for liquid and gas handling, for medical, process, and industrial applications...

Wuxi Word Search 2023-08-25

12 Items: Asian facilityEurope facilityNorthern North America facilitySouthern North America facilitypump units that are as small as a coin or a paper clipthe first choice for moving demanding fluids gently without any system downtimesolution pump for liquid and gas handling, for medical, process, and industrial applications...

Spatial PhenoSearch! 2023-08-10

10 Items: Proteins that are activated in the same cell.Natural emission of light by biological structures such as tissues.Overlapping excitation and emission wavelengths of two or more fluorescent dyes.Emission filters that capture the peaks and part of fluorophore emission wavelengths....

Invertebrate vocab 2024-01-22

27 Items: cucumbers.and clams.echinoderms.respiration.pollination.in arthropods.identical to the parent.Organisms that primarily feed on plants.Animals lacking a backbone or vertebral column.Organisms that primarily feed on other animals.The variety of life within a specific ecosystem or habitat....

Ch. 15 Safety and Physical Activity 2022-11-03

19 Items: inactivelower body temperature than normalnormal healthy condition of musclesmental or physical tension or pressurebeing supplied with enough water or fluidthe prevailing weather conditions of a placethe full distance and direction a joint can movethe ability of joints to move through a full range of motion...

Ch. 15 Safety and Physical Activity 2022-11-03

19 Items: inactivelower body temperature than normalnormal healthy condition of musclesmental or physical tension or pressurebeing supplied with enough water or fluidthe prevailing weather conditions of a placethe full distance and direction a joint can movethe ability of joints to move through a full range of motion...

FUELS 2023-05-03

12 Items: Substances made up of only hydrogen and carbon atoms.Heat energy extracted from the Earth through hot water or steam.Energy from captured solar radiation to use for hot water and electricity.Atmospheric motion generated by the uneven heating of Earth's surface by the Sun....