cells Word Searches

CELLS 2017-06-16

24 Items: DNARNACELLWALLORGANPLANTANIMALTISSUEMITOSISNUCLEUSOSMOSISVACUOLEORGANISMRIBOSOMEMEMBRANECYTOPLASMDIFFUSIONLYSOSOMESNUCLEOLUSCHROMOSOMEMICROSCOPEORGANELLESCHLOROPLASTSMITOCHONDRIA

Cells 2022-09-28

20 Items: cellplanttraitanimalmendelnucleusvacuoleorganismmembraneribosomedominantinstinctcytoplasmeukaryoteinheritedrecessiveprokaryoteadaptationchloroplastmitochondria

Cells 2013-11-30

39 Items: CellOrganTissueNucleusVacuoleOsmosisRibosomeLysosomeIsotonicCell-wallEukaryoteOrganelleCytoplasmChromatinNucleolusCentrioleDiffusionHypotonicProkaryoteChromosomeHypertonicCell-theoryChloroplastEquilibriumEndocytosisPinocytosisCytoskeletonPhagocytosisOrgan-systemMitochondrionCell-membraneLipid-bilayerConcentrationGolgi-apparatusNuclear-envelope...

Cells 2022-09-12

24 Items: armlifewallbasecellsstagefocuslightgrowthvacuolenucleusmovementmembraneeyepiecenutritionexcretioncytoplasmobjectivemicroscoperespirationsensitivitychloroplastreproductionmitochondria

CELLS 2017-06-16

24 Items: DNARNACELLWALLORGANPLANTANIMALTISSUEMITOSISNUCLEUSOSMOSISVACUOLEORGANISMRIBOSOMEMEMBRANECYTOPLASMDIFFUSIONLYSOSOMESNUCLEOLUSCHROMOSOMEMICROSCOPEORGANELLESCHLOROPLASTSMITOCHONDRIA

Cells 2022-09-28

20 Items: cellplanttraitanimalmendelnucleusvacuoleorganismmembraneribosomedominantinstinctcytoplasmeukaryoteinheritedrecessiveprokaryoteadaptationchloroplastmitochondria

Cells 2017-02-23

19 Items: dnarnaacidacidlipidaminoenzymeactiveelementnucleicproteinosmosispassivecompoundpermeablediffusiontransportselectivelycarbohydrate

Cells 2014-05-19

19 Items: dnacellcellcellcycleplantcellsanimalmitosishealingnucleusanaphaseprophasetelophasemetaphasechromosomeinterphasereplicationcytokinesis

Cells 2018-09-27

17 Items: OrganTissueSystemNucleusVacuoleCellWallMembraneRibosomeLysosomeOrganelleCytoplasmReticulumApparatusChloroplastUnicellularMitochondriaMulticellular

Cells, Cells and More Cells 2024-01-10

29 Items: cellbioticamoebaabioticosmosiseuglenalysosomevacuolesorganismssymbioticcytoplasmribosomescell-walleukaryoticcentriolesparameciumunicellularprokaryoticcell-theory(apparatus)(reticulum)mitochondriachloroplastsmulticellularcell-divisioncell-membranemicroorganismsmacroorganismsphotosynthesis

Cells 2022-10-21

26 Items: genenucleusvesiclevacuolecellwallribosomelysosomecytoplasmcentriolechromatinnucleoluseukaryoticleucoplastprokaryoticchloroplastchromoplastnuclearporechromosomescellmembranemitochondriacytoskeletongolgiapparatusribonucleicacidnuclearenvelopeendoplasmicreticulumdeoxyribonucleicacid

Cells 2023-06-16

21 Items: contains DNAsites of photosynthesisan undifferentiated cellsites of protein synthesissites of aerobic respirationwhen cells become specialisedmovement low to high using energythe first stage of the cell cyclethe final stage of the cell cyclewhere chemical reactions take placecontains cell sap to keep cell turgidcellular process that releases energy...

CELLS 2023-09-01

20 Items: dnafungitheoryplantsschwannvirchowanimalsbiologymembranebacteriaorganismschleidenribosomesmicroscopeeukaryoticorganellesunicellularleeuwenhoekprokaryoticmulticellular

Cells 2019-11-11

15 Items: PlantAmoebaAnimalNucleusGeneticBuddingCellwallBacteriaCytoplasmUnitoflifeCellmembraneChloroplastsGrandmaBobbyMulticellularBinaryfission

Cells 2017-02-03

15 Items: cellwallpilinucleusplasmidcapsuleribosomemembranenucleoidflagellalysosomeeukaryotecytoplasmprokaryotemitochondria

Cells 2014-12-02

11 Items: Nucleusribosomechromatinnucleoluscytoplasmlysosomesorganellesgolgibodiesmitochondriacellmembraneendoplasmicreticulum

Cells 2 2022-01-19

24 Items: gapcellcyclegrowthrepaircancerbenignmitosisgeneticvirusessurgeryprophaseanaphasesynthesismetaphasetelophasemalignantchemicalsradiationinterphasecytokinesismetastasizechemotherapyenvironmental

Cells & organelles !!! 2023-03-26

22 Items: dnacellnucleusvacuoleroughercellwallribosomelysosomesmoothercourtneyorganellecytoplasmreticulumeukaryoteprokaryoteanimalcellcelltheorychloroplastendoplasmiccellmembranemitochondriongolgiapparatus

Cells & Organelles 2023-02-15

27 Items: dnawallbodycellsgenesfungiplantsnucleusarchaeaanimalsvacuolemembraneprotistsbacteriareticulumribosomescytoplasmlysosomeseukaryotesorganellesprokaryoteschromosomesunicellularmitochondriachloroplastsmulticellularphotosynthesis

Cells & Organelles 2024-04-06

27 Items: dnawallbodycellsgenesfungiplantsnucleusarchaeaanimalsvacuolemembraneprotistsbacteriareticulumribosomescytoplasmlysosomeseukaryotesorganellesprokaryoteschromosomesunicellularmitochondriachloroplastsmulticellularphotosynthesis

cells, Cells, CELLS!!!!! 2022-12-01

8 Items: Packets of RNA and proteinOnly found in plant cells and they make plants greenFound in eukaryote cells and it makes them what they areIt is only found in plant cells and it is a protective barrierActs as a protective barrier to the uncontrolled flow of waterCommonly found in animal cell and they are in white blood cells...

Cells & Organelles 2022-02-08

16 Items: nucleusroughervacuolecellwallsmoothercytoplasmgolgibodylysosomesamyloplastcentrosomeunicellularchloroplastsmitochondriacellmemebranemulticellularnuclearmembrane

HeLa cells 2022-10-03

17 Items: agehelatumorpolioviruscellsbloodcancertoxinsimagingscienceimmortalhenriettabaltimoretreatmenttelomerasejohnhopkins

Cells Wordsearch 2023-04-30

17 Items: dnanucleusproteinvacuolefunctionorganellecytoplasmnucleolusribosomesorganellelysosomeschromosomesgolgibodiescellmembranemitochondrianuclearmembraneendoplasmicreticulum

Body Systems & Cells 2017-03-24

30 Items: cellorganscalesystemtissuebioticvacuoleabioticmembraneribosomelysosomestimulusresponsetransmitfunctionorganellecytoplasmgolgibodynonlivingcelltheoryeukaryoticmicroscopecomponentsprokaryoticendoplasmicchloroplasthomeostasismitochondriacytoskeletonneuralpathway

Muscular system 2014-02-23

16 Items: BellyBicepsOriginMusclesTricepsMyofibrilInsertionCell-NucleiMuscle-FibersNeouromuscularSynaptic-CleftMuscular-SystemSupporting-TissueContractile-TissueSmooth-Muscle-CellsStriped-Muscle-Cells

Cells 2023-09-12

8 Items: wallnucleusvacuolemembraneribosomecytoplasmchloroplastmitochondrion

Muscular system 2014-02-23

15 Items: BellyBicepsOriginMusclesTricepsMyofibrilInsertionCell-NucleiMuscle-FibersNeouromuscularSynaptic-CleftMuscular-SystemContractile-TissueSmooth-Muscle-CellsStriped-Muscle-Cells

cells 1 2017-03-23

15 Items: cellosmosisopticalplastidsisotonicdarkfieldlysosomesribosomescelluloidphosolipidhomeostasismitochondriasemipermeableactivetransportendoplasmicreticulum

Cells 2019-09-18

9 Items: NucleusVacuoleNucleusMembraneCellwallPlantcellCytoplasmAnimalcellChloroplast

cells 2023-02-20

8 Items: wallvacuolenucleusmembranecytoplasmchloroplastchlorophyllmitochondria

5. Cells & Energy 2022-11-02

22 Items: without oxygenSugar (C6H12O6)requires oxygenBasic unit of lifethe outer covering of a cell or organelleget their energy from the sun, example plantsplace in a eukaryotic cell where the DNA is locatedtiny structure that performs a specific job in a celladenosine triphosphate, a molecule that stores energy...

Cells Word Search 2023-12-07

41 Items: growcellsorganhookeroughplanttissuesystemtheorysmoothanimalenergystableschwannvirchownucleusvesiclevacuoledeveloporganismmembraneribosomelysosomecellwallstimulusorganelleschleidencytoplasmnucleoluseukaryotereproducemicroscopeprokaryotechloroplastadaptationsmitochondriacytoskeletonorganizationvanleeuwenhoekgolgiapparatusendoplasmicreticulum

Body Systems & Cells 2017-03-24

31 Items: cellgolgiorganscalesystemtheorytissueorganslivingbioticvacuoleabioticmembraneribosomelysosomestimulusresponsetransmitfunctionorganellenonlivingeukaryoticmicroscopecomponentsprokaryoticendoplasmicchloroplasthomeostasismitochondriacytoskeletonneuralpathway

Cells Word Search 2024-05-21

15 Items: the smallest unit that can live on its own.provide support and movement to the soft tissues.a type of fibrous connective tissue that links your muscles and bonesA type of blood cell that is made in the bone marrow and found in the blood.a type of eukaryotic cell that lacks a cell wall and has a membrane-bound nucleus...

Science Terminology 2013-11-13

16 Items: cellsordercycadsspeciesagnathamineralschordateparasitedecomposesmonotremesmicroscopicectothermicendothermicosteichthyesdichotomouskeychondrichthyes

Science Terminology 2013-11-13

16 Items: cellsordercycadsspeciesagnathamineralschordateparasitedecomposesmonotremesmicroscopicectothermicendothermicosteichthyesdichotomouskeychondrichthyes

Microscopes 2024-04-29

17 Items: dnawallbloodcellsplantanimalnucleusvacuolemembraneorganismcytoplasmdiaphragmribosomesorganellesmicroscopeschloroplastsmagnification

THE RESPIRATORY SYSTEM 2021-06-04

13 Items: bodylungscellslarynxoxygensystembronchialveoliwindpipediaphragmnasalcavityrespiratorycardondioxide

Science 2 2024-05-08

13 Items: aortaveinsbloodcellsplasmaoxygenarteriesplateletsnutrientsvenacavaecapillariesredbloodcellswhitebloodcells

Nancy 2015-03-05

19 Items: keptcellsreadyshalllengthEuroperaisedregionsimplegeneralclothesmembersperhapsfinishedinterestsuddenlybeautifuldevelopedparagraph

Cells and Particles Revision 2018-01-22

30 Items: egggaspureplantspermnervesolidanimalmuscleliquidNucleusvacuoleboilingmeltingdensityheatingcoolingmixturecellwallroothairpalisadefreezingparticlecytoplasmsubstancecondensingcellmembranechloroplastsdistillationphotosynthesis

Science Terminology 2013-11-13

16 Items: cellsordercycadsspeciesagnathamineralschordateparasitedecomposesmonotremesmicroscopicectothermicendothermicosteichthyesdichotomouskeychondrichthyes

Animal vs. Plant Cells 2023-05-10

16 Items: cellsnucleuscellwalllysosomevesiclescytoplasmgolgibodynucleoluscentrosomecentrioleseukaryoticchloroplastcellmembranemitochondriacentralvacuoleendoplasmicreticulum

Search time! 2024-01-10

16 Items: datarowscellschartgraphmergeexcelcenteranalyzecollectcolumnshandlinginternetorganizesoftwareinformation

Muscle System 2016-04-06

12 Items: flexBloodcellsjointbicepstendonfiberssmoothmusclescardiactissuesskeletal

Child Psychology Terms 2014-09-18

17 Items: stemcellsgameteanoxiaeffectcouvadegenotypephenotypepolygenicthresholdteratogensequilibriumassimilationconditioningaccommodationreinforcementtoxoplasmosis

Skeleton Word Search 2024-05-23

20 Items: dnaskinbrainheartlungscellsbloodbonesimmuneorgansmusclesnervoustissuesskeletonskeletaldigestiveendocrinecirculatoryrespiratoryreproductive

Vitamin K & Water 2017-04-24

14 Items: cellsWaterorganscancertissuesvomitingdiarrheaVitaminKtoothdecayDehydrationBloodcottingheartdiseaseWeakenedbonesexcessivesweating

Satellites Word Search 2023-11-09

14 Items: sunsolarroofscellspanelsenergysavingbatterystoragevoltagesunlightpollutionsatelliteselectricity

science 2022-05-11

19 Items: judecellsfungifibrecarbsbotanydegreescelsiusproteinomnivoresevolutionnutrientsherbivorescarnivoresbiologistsvertebratesvertebratesinvertebratesphotosynthesis

Cardiovascular System 2014-01-05

13 Items: redheartbloodcellswhitesystematriumvalvesvesselsarteriesventriclecapillarycardiovascular

The Immune System 2016-04-07

19 Items: HIVCellsImmuneOrgansSpleenThymusDefenseTissuesAllergiesPhagocytesNeutrophillymphnodesBonemarrowLeukocyteslymphocytesVaccinationImmunizationHypothyroidismAutoimmunedisease

Living things - MRS C. GREN 2023-05-31

19 Items: mosscellsfungiplantalgaegrowthmoneraanimalamoebaprotistmovementbacteriamushroomexcretionnutritionrespirationsensitivityreproductionlifeprocesses

Cells and genetics 2014-04-16

17 Items: DNAunitgenesvirusallelecarriergeneticsmutationproteinspurebredX-linkedproteomeevolutionrecessivechromosomesprobabilityinheritance

Biosimilar Biologics 2023-03-22

20 Items: cellsanemiahumirainsulincheaperhumaloglovenoxvaccinespsoriasisenoxaparinadalimumabhealthgoalbiosimilaroriginatorallergenicsbiologicdrugsinsulinlisprocommunicationprofessionalismbiologicalsource

Excel in Business Word Search 2024-04-30

20 Items: datarowscellsexcelbudgetsanalyzefiguresfinancecolumnsmanuallyoutcomesemployeeprogramsformulasefficientdecisionsworkplacecategorizespreadsheetsadministrators

the Human Body 2024-05-08

20 Items: skincellsbrainheartlungsliverbloodorganstissuesmusclesstomachkidneysskeletonimmunesystemnervoussystemdigestivesystemendocrinesystemcirculatorysystemrespiratorysystemreproductivesystem

Flexography/Gravure 2023-05-18

15 Items: inkflexocellsrotaryplatescopperqualityinkbathgravureetchingflexibleengravinganiloxrollerphotopolymerimpressioncylinder

Cell Theory 2021-10-04

16 Items: lifecorkcellsBacteriaExistinggenerationCellTheoryMicroscopeRobertHookeSpontaneousFrancisRediLouisPasteurRudolfVirchowZachariasJanssenMatthiasSchleidenAntonvanLeeuwenhoeke

Cell Theory 2021-10-04

16 Items: lifecorkcellsBacteriaExistinggenerationCellTheoryMicroscopeRobertHookeSpontaneousFrancisRediLouisPasteurRudolfVirchowZachariasJanssenMatthiasSchleidenAntonvanLeeuwenhoeke

Characteristics of Life 2023-09-15

16 Items: rizzcellsgrowthbiologyrizzgodorganismstimulusresponserizzlordadaptationmetabolismdevelopmenthomeostasisrizzardofozorganizationreproduction

Organisms 2019-03-25

13 Items: cellsfungicellsplantskingdomanimalsprotistseubacteriaeukaryoticunicellularprokaryoticmulticellulararchaebacteria

biology 2020-10-20

12 Items: cellcellscycleenergytissueorgansmitosiscellularreproducerespirationchromosomesphotosynthesis

You are what you eat - Vocabulary 2023-04-20

12 Items: foodheartbloodcellssystempyramidhealthyvesselsnutritiondigestionrespirationcirculatory

Genes 2016-03-15

16 Items: GenesCellsAdenineGuanineThymineCytosineProteinsBlueprintsChromosomesNucleotidesDoublehelixGregorMendelSugarmoleculesGeneticallyuniqueInheritancepatternsDeoxyribonucleicacid

Cell Division 2021-06-21

16 Items: fibercellspolesmitosisspindlenucleusprophaseanaphasedaughtermetaphasetelophasecentrioleinterphasecentromerechromatidscytokinesis

Cell Division 2021-06-21

16 Items: fibercellspolesmitosisspindlenucleusprophaseanaphasedaughtermetaphasetelophasecentrioleinterphasecentromerechromatidscytokinesis

Automative 2015-12-15

15 Items: OILGASPADPARKAMPSHOODHEADSCELLSPISTONFILTERTIMINGPRESSURESTEERINGCARBURATORMICROMETER

Renewable and Nonrenewable Resources 2023-01-23

15 Items: sunoilgaswindcoalsolarwatertreescellsenergypanelsturbinesrenewableelectricitynonrenewable

Animal cells 2023-10-31

9 Items: proteinvacuolecytoplasmbeanshapecellbrainprotectionchromosomescellmembranemitochondria

Science 2015-04-08

19 Items: gassolidcellssolarLiquidenergyenergymatterenergykineticmixturelearnedsystemssolutionbehaviorpotentialinheritedorganismsmolecules

Science 2023-09-12

17 Items: finscellsoxygenmatterforcesdensitygravityskeletonreptilesarteriesnutritiontentaclesdiaphragmexhalationpollinationechinodermsphotosynthesis

cells 2022-11-06

6 Items: nucleusvacuolecytoplasmribosomeslysosomesmitochondria

ANIMAL AND PLANT CELLS  2016-08-25

21 Items: CELLBODYCELLWALLGOLGIORGANCELLSTISSUEPLASMANUCLEUSNUCLEURDIPLOIDMEMBRANEMEMBRANEMEMBRANERIBOSOMESCYTOPLASMLYSOSOMESORAGNELLECHROMOSOMEMITOCHONDRIA

Science Word Search 2014-12-04

13 Items: cellsatomicdilutebiologypolaritybacteriacatalystuniversevariablesamphibianscondensationbiodegradablephotosynthesis

Electricity (2) 2015-06-24

13 Items: ZincFlowVoltsWiresCellsLemonsCopperMeasureVoltmeterElectronsTerminalsElectrodesElectrolyte

The Immune System 2016-04-07

19 Items: HIVCellsImmuneOrgansSpleenThymusDefenseTissuesAllergiesPhagocytesNeutrophillymphnodesBonemarrowLeukocyteslymphocytesVaccinationImmunizationHypothyroidismAutoimmunedisease

Crime related vocab 2023-04-30

11 Items: sirenradiocellslawyercustodyofficercautionhandcuffspolicecarinterviewpolicestation

Cells and Particles Revision 2018-01-22

29 Items: egggaspureplantspermnervesolidanimalmuscleliquidNucleusvacuoleboilingmeltingdensityheatingcoolingmixturecellwallroothairpalisadefreezingparticlecytoplasmsubstancecondensingcellmembranechloroplastsdistillation

G8 - Cells & Systems Vocab. 2022-11-14

38 Items: what something doesthe brain of the cellhow something is shapedmade up of only one cellstores water in the cellmade up of more than one cellan organ system that creates lifethere are 4 of these in your heartan organ system that helps you moveAll cells come from __________ cellskeeping a body's internal conditions stable...

All about Atoms 2015-12-22

10 Items: GainIonsLoseCellsNobleNucleusPeriodsProtonsElementsSmallest

science review 2014-04-23

12 Items: cellsmatterstormsmagnetssciencetornadofrictionwheatherplantcellselectricityanimalcellsstaticelectricity

Sudoku Puzzles 2023-10-11

21 Items: fillhardrowscellsnakedxwingblocksexpertgivenspuzzleregionuniqueinvalidsubgridquadranteliminationpencilmarksjigsawsudokukillersudokuthermosudokucrosshatching

Science 2019-09-04

20 Items: earthspacecellsatomsplantshumansenergybiologyphysicsanimalsplanetschemistrychemicalsreactionsradiationlaboratoryecosystemsenvironmentdissectionsperiodictable

Digestive System 2020-08-31

20 Items: tubeholemouthliverfluidcolonglandvillifibercellstastetonguegulletsalivaamylasepancreasdigestiveesophagusgallbladderperistalsis

Physiology Words 2014-02-12

20 Items: BodyCellsHumanStudyLearnOrgansSystemsScienceObserveBiologyOrganismSkeletonOperatesFunctionsStructureDiscoveryScientistPhysiologyExperimentPhysiologist

The Human Body 2017-02-27

20 Items: jobsbonesheartcellsorgantissuestrokearterynervousmusclesdiseaseskeletalmuscularproblemssyndromeepilepsydigestivecirculatoryhemorrhoidshypertension

Microscope Wordsearch 2018-01-23

20 Items: ARMBASELAMPCELLSSTAGEPOWERLENSESMITOSISMEIOSISAPERTUREEYEPIECELOWPOWERHIGHPOWEROBJECTIVENOSEPIECEADJUSTMENTLABORATORYMICROSCOPESTAGECLIPSFINEADJUSTMENTKNOB

Cells and DNA Word Search 2022-11-25

20 Items: dnacellsvirusmutatetraitsnucleusvacuoledominantcellwallgeneticsbraincellcytoplasmplantcellskincellsbloodcellsnervecellsanimalcellmusclecellscellmembranemitochondria

BLOOD 2023-08-16

20 Items: redclottypesdonercellsplasmarhesusoxygenanemiaantigensbiconcaveplateletsfragmentstransporthemoglobinleukocytesantibodieserythrocytesmicroorganismagglutination

Human Anatomy 2024-02-28

21 Items: cellsimmunejointsorgansnervousurinarytissuesskeletalmusculardigestiveendocrinelymphaticcirculatoryrespiratoryrespiratoryreproductiveintegumentarysensoryorganscardiovascularendocrineglandsskeletalframework

Medieval Indian Empire 2015-12-21

15 Items: HUNSTHARRIVERCAVESCELLSGANGESGOLDENEMPIREAJANTAGUPTASDYNASTYFRESCOESHIMALAYABYZANTINEMOUNTAINS

Genes 2016-03-15

16 Items: GenesCellsAdenineGuanineThymineCytosineProteinsBlueprintsChromosomesNucleotidesDoublehelixGregormendelSugarmoleculesGeneticallyuniqueInheritancepatternsDeoxyribonucleicacid

Characteristics of Living Things 2017-08-28

16 Items: DNAusegrowcellsobtainenergychangedeveloprespondstimuliinheritedorganismsmetabolismunicellularmulticellularchemicalreactions

MICROSOFT EXCEL 2018-08-15

16 Items: tabrowsumsortcellsgraphrangescolumnchartsformatformulacountifworkbookfunctionsignatureconditional

Cell Division 2021-06-21

16 Items: fibercellspolesmitosisspindlenucleusprophaseanaphasedaughtermetaphasetelophasecentrioleinterphasecentromerechromatidscytokinesis

Vitamin K & Water 2017-04-24

14 Items: cellsWaterorganscancertissuesvomitingdiarrheaVitaminKtoothdecayDehydrationBloodcottingheartdiseaseWeakenedbonesexcessivesweating

Cell Energy  2020-11-25

18 Items: ATPNADHbombcellssugarEnergyribosefossilsmembranemoleculesnutrientsoxidationadenosineeukaryotesglycolysiscalorimetermitochondriaphotosynthetic

Labweek Word Search 2024-04-11

18 Items: ppehoodmediacellsrobotflaskbuffergiemsabiohitslideslabcoatbacteriamutazymeincubatorvolumetriccolchicineformulationscoultercounter