car Word Searches

Language Cafe Word Search 2024-07-18

80 Items: 你好再见谢谢是的nono食物帮助朋友家庭房子汽车学校早上夜晚youyesouieauamicarcatdogholaneinaguafoodcibohelpaidelovecasaautobookgatochathundcanehellofavordankewateressenayudaliebeamoreamigohouselibrolivrematinnightnachtnottepleasegraziefriendfamilymaisonschoolschulescuolamañanabonjourgoodbyefamiliemorningfamigliamacchinavous plaîtWiedersehenarrivederci

road trips 2025-04-21

101 Items: cargasiowaohioutahtriprainfuelidahomainetexasstateroadshillsparkshoteltollsmusicradiosunnystormwindytreesalaskahawaiikansasnevadaoregandesertforestplainsplatestravelmilagesnackshikingbreaksalabamaarizonafloridageorgiaindianamontananewyorkvermontwyomingmidwesttornadocanyonsbordersdrivinglicensecampingpackingluggageweathertraffichighwayarkansas...

Dolch nouns 2025-09-30

95 Items: bedboxboycarcatcowdaydogeggeyelegmanmenpigsuntoptoywaybabybackballbearbellbirdboatcakecoatcorndolldoorduckfarmfeetfirefishgamegirlhandheadhillhomemilknamenestrainringseedshoesnowsongtimetreewindwoodapplebreadchairfloorgrasshorsehousekittymoneynightpaperpartyrobinClaussheepsticktablethingwatchwaterfarmerfatherflowergardengroundlettermotherrabbit...

Ohana Word Search 2026-03-11

7 Items: Enjoy dinner in a carTravel back to Colonial timesMind your manners in this 1950s kitchenWatch fish, sharks, turtles, and rays swimWatch the monorail come and go while you eatAn immersive, family-style Polynesian experienceThis is where I learned the history of the sandwich

Unit 4 2026-02-10

38 Items: qù, go tozero (líng)two (liǎng)qì chē - carminute (fēn)wǔ faǹ,lunchnow (xiànzài)jǐ - how manyzǒu lù to walkfēi jī - planeo'clock (diǎn)huǒ chē - trainwaň faǹ,dinnerchuán - ship, boatshang̀ wǔ, morningzaǒ shang̀, morningzaǒ faǹ, breakfastfall short of (chà)měi tiān - every daydì tiě subway; metrowaň shang̀, eveningto sleep (shuì jiào)...

LANGUAGE BUILDER 2024-04-07

19 Items: Toà nhàVăn phòngQuầy lễ tânNhà vệ sinhOpposite to nearOpposite to leftOpposite to openOpposite to fullOpposite to earlyOpposite to largeYou buy medicine hereWhere you play sportsYou park your car hereYour money is safe hereYou can buy anything hereATM is another term for thisYou send letters, parcels here.You can read or borrow books here...

I Love You 2026-04-16

19 Items: Your carPray TellLittle manMinion StimYour streetYour #1 movieDrink you likeYour fav colorOrder at paneraRio...no elaboratingBaby/Family nicknameMy baby at your houseNickname I have for youFirst drink in the morningWhere we had our first dateSomething we always eat at homeState you drove to for your wheelsFirst city we travelled to together...

Summer of the Mariposas Chapters 1-7 2025-10-15

15 Items: Mother to InesNumber of sistersLeader and narratorOdilia's magical itemThe baby of the familyThe dead man's first nameSpanish for "butterflies"State where the girls liveMama's job is a __________Country the sisters travel toMythical creature guiding the girlsAnimal that symbolizes transformationFavorite game played by the Garza family...

Movies and Series 2026-05-27

15 Items: DinosaursClown. a movieCar fast, a movieClassic Horror movieBest 2000s girly genre?Series thats from koreaSeries thats from ChinaMe? a princess? Shut up!Shes not cordelia! a movieon wednesday, we wear pinkone very cold queen, a movieMarrying a hot demon, a seriesThe genre that will make u scream5 teen's friendship im jealous of, a series...

Car Word Search 2025-01-23

1 Item: car

June & Char 2026-01-27

9 Items: Where did we first meet?Where was our first kiss?Where did you ask me out?Name of stuffy you first got me?Symbol of bracelets I first got us?Favorite thing to say to each other?First iMessage game we played together?Where would we always hang out during school?Favorite thing we used to do at school at night?

Latin word search 2025-12-09

15 Items: in the areastarting a fireto give to someonesomething being wonsomeone who has wonfleet of weapon shipsa gift toward someonebeing a representativeif you support your causeif you are worthy you havenot understanding out of spitestarting a spark to start a carplace where the weapons are heldgroup of people that fight for a thing...

/r/ Production Practice 2024-09-29

10 Items: The race is "ready" to start.The "rose" is "red" and nice.The "rabbit" was running away."Robots" are really fun to see.The road was in a "remote" area.The "raven" was watching the ride.The car was "racing" down the road.He loved to "read" about the "rings"."Rough" conditions stopped the rescue.The wind was "rapidly" making a rotation.

Kenny’s Great Big Word Search! 2026-02-13

10 Items: Your car name“Will you be my…?”Your favorite colorYour favorite artistYou say this word a lotYour (OUR) school mascotOur favorite meal to cook together“You make me feel like I’ve been locked out of…”Where I had Indian food with you for the first timeThe name of the cafe we had our first date location in Oxford

June & Char 2026-01-27

9 Items: Where did we first meet?Where was our first kiss?Where did you ask me out?Name of stuffy you first got me?Symbol of bracelets I first got us?Favorite thing to say to each other?First iMessage game we played together?Where would we always hang out during school?Favorite thing we used to do at school at night?

June & Char 2026-01-27

9 Items: Where did we first meet?Where was our first kiss?Where did you ask me out?Name of stuffy you first got me?Symbol of bracelets I first got us?Favorite thing to say to each other?First iMessage game we played together?Where would we always hang out during school?Favorite thing we used to do at school at night?

Word Search #1 2025-07-03

13 Items: Where do you play?Where do you sleep?What has eight sides?Where do you eat meals?What is made from trees?Where meals are prepared?Where do you park your car?What is soft but stepped on?Where do you store your food?Where is the best place to be?What holds your plates and cups?What takes you from point A, to point B?...

Idioms and adjectives to describe feelings 2024-12-10

12 Items: Before the exam results came out, I was on edge.When I heard that I got the job, I was over the moon.When she saw her friend's new car, she was green with envy.After trying to explain it five times, I was at my wit's end.She's been down in the dumps after her best friend moved away.She was scared stiff when the roller coaster plunged downwards....

My first 50 words 2023-02-14

50 Items: unoaguataximesarojovidacasaniñacafégatoniñoazulcamamujerfaldaaviónplumahotelamigoperrorelojsillacochenegrobolsoángelinglésblancoshortsdinerohombrecomidabailarciudadlibroszapatosnaranjavestidobotellamanzanaamarilloparaguasnoticiaschamarraenfermeraluz/ligerohamburgesacocinero/chefcompañeros de clasepantalón de mezclilla

Spanish recap 2023-07-20

30 Items: a cara busa beda farma towna citya housea coacha tablethe poola windowI live ina cottagethe beachthe atticby the seathe churchthe cinemato sunbathethe kitchenan aeroplanethe water parkthe theme parkto the left ofthe post officeto the right ofthe living roomthe dining roomto swim in the seathe shopping centre

Review Words Level 1 2024-07-19

103 Items: axoxupantbedcatcupcardogeggfanhatdoginkjetjamkeynutnetpensunvanvetwebfoxboxsixwaxyakzoobearbirddeskdollduckfishfarmforkgoatgiftgirlkingkitelionlampleafmilknestnosequizrosericesealsoaptentvestwolfzeroappleelbowhorsehouseigloojuicelemonmouseolivepeachpandaqueenquiltrobotsockstigerunclewaterwatchyo-yoyachtzebrabananainsectiguanajacketmonkeyrabbit...

Bank Accounts and Terminology 2025-06-21

21 Items: VISA$19 feeLoan for a CarRetirement planLoan for a HouseNo minimum balanceCredit for a HouseType of InvestmentSignature Guarantee$5 to keep account openMinimum balance of $2500Educational Savings PlanTotal Amount of InterestType of Overdraft ProtectionAnnual Cost of Borrowing MoneyMonetary Instrument with $3 feeMonetary Instrument with $5 fee...

Our own 2026-03-29

35 Items: readreadplayselfdrivecatchtrackspeedsnailstudystrongnova isdance taplast nameI love youvideo gamelift heavyour schoolDaddy's sonhappy danceflip on barwe are happyplace to learnto talk to godlove seeing itDaddy's daughterGia and nova dadDaddy's computerwhat's your nameJackson musicianPettit & Stadokasomething to watchour favorite color...

car 2024-03-20

1 Item: ferrari

yuleysi's word search 2023-03-03

20 Items: sky colorfeel goodgrass colora dark colorbrown personyour moms momfixes your carcuts your hairwhat you see withyou use it to talkwhen you feel downyou drink to hydratewhat people call youthe color of the sunmexican eat them a lotsomewhere you go to learnyou eat it a lot in the summersomething healthy besides veggies...

Saffron and Ashley OO 2024-09-17

25 Items: Groom hobbyMonth we metGroom hometownGroom Star SignBride star signBride eye colourFlower girl nameBride birth monthWhere did we meetGroom Middle nameBride middle nameGrooms high schoolNumber of best menMonth of engagementPlace of engagementMost recent concertMother of Bride nameMother of groom nameGrooms favourite carCouples first holiday...

Viajes 2025-11-11

46 Items: RVcarbuscitylakeboatriverruinscabinplanetrainmuseumislandforestdesertto skicastletempleticketcameracruiseflightvolcanoto hiketo rideto swimto stayto packto camppyramidto floatto relaxto visitsouvenirpassportsuitcasemountainsto travelcathedralwater parkto explorecountrysideto sightseeto scuba divenational parkamusement park

Christmas Word Search 2022-12-22

17 Items: frozen rainSanta's carChristmas Grandpathe sound of bellssomething for a fireanother word for giftan old word for happywhat we do to the treeput the gifts under thiswhat month is Christmas?another place to put giftskids want these from Santaa treat we leave for santathey carry Santa in the skythey help Santa make the gifts...

Safety Week Word Search 2026-04-09

17 Items: G______ WalkPPE for your eyesPPE for your feetPPE for your bodyLock Out T___ OutFire E__________.PPE for your earsPPE for your handsPed Seg keeps who safer?It might be something dangerousWork Safely to Prevent an I_____.Probably weighs more than your carCall N______ Triage in an emergencyUse to clean out your eyes in emergency...

Mark’s Birthday Celebration 2026-06-08

20 Items: mario’s brotherclassic vw modelbuilding made of sandhandheld gaming devicecompetitive video gamingriding waves at the beachsmall sweet birthday treatjax oceanfront destinationporsche performance featureprize awarded to the winnerbody of water beside the beachbarrel throwing ape arcade gamecountry where Porsche originated...

trs23 ie2 u3p2 2022-11-16

10 Items: Doesn't work.It has 2 wheels.It can fly. It has wings.It's big and has 4 wheels.It can fly. It doesn't have wings.It's very big and has 4 wheels. (Br)It's very big and has 4 wheels. (US)You can see it on a yo-yo and a kite.It is round. It is on a car and a bus.Two overlapping circles with things inside.

Iloveyou Word Search 2026-02-03

10 Items: our first kissour fav icecreamwhere we first metfirst board game together"you only **** 1/3 of me??"these are growing in your backyard!i <3 early morning breakfast with you herea ray rays best friend (hint: "a mans best friend")model of car i accidentally hit in the garage freshman year...

English III 2026-04-06

10 Items: Camels live in the _________Have you ever _____ in a plane?I booked our tickets 2 days _____A bike is __________ a car (cheap)I need to know how to use a ________The garden is a mess, can you _________?He works in an office, he is a ___________why don't you ______ this local dish? (verb)I like cold weather, that's why I like ______...

Site words 1 2023-01-13

113 Items: hegoinismetoitmyweonatasofifambedonousuporcanyouseegetnotanddidrunforwasareallbigboybutcardayeatfunhadhasherhimhishownewnowoffoldoutransawshewhywhooneusetwoanysaidhavelikeawaybestcomedownfromgirlgivegoodherelookmademakeoverplaysometellthatthemtheythisthemwantwhenwhatwentwillwithyourweregirleachbeenwordmanyintodoesafteraboutcan’thousetherethingwould...

CHAPTER 8 2025-04-29

103 Items: ADDONLYTIMEONLYALSOWHENPLACETHERELIMITMEANSREALLYDEGREEREALLYMANNERBY-CARPROVIDEPROCESSFRANKLYHOWLONGSTANDINADJUNCTSNEGATIONFOCUSINGLIMITERSSLIGHTLYLOCATIONHOWOFTENPROFORMSVIEWPOINTYESTERDAYDISJUNCTSCONJUNCTSTHEREFOREAFTERVERBADDITIVESINTENSITYCAREFULLYDIRECTIONEMPHASIZEADVERBIALSAFFECTEDBYPERIPHERALAMPLIFIERSCOMPLETELYDOWNTONERSINSTRUMENT...

My first 50 words 2023-02-14

50 Items: unoaguataximesarojovidacasaniñacafégatoniñoazulcamamujerfaldaaviónplumahotelamigoperrorelojsillacochenegrobolsoángelinglésblancoshortsdinerohombrecomidabailarciudadlibroszapatosnaranjavestidobotellamanzanaamarilloparaguasnoticiaschamarraenfermeraluz/ligerohamburgesacocinero/chefcompañeros de clasepantalón de mezclilla

Do Word Search 2023-05-17

28 Items: hooverget upget homego to bedwatch DVDsplay chesshave lunchgo shoppingget dressedhave dinnerdo homeworkwash the cartidy my roomsurf the Netgo to schoolhave a showerdo the washingread magazineshave breakfastlisten to musicbrush my teethgo to the cinemaclean the windowsdo the washing-uptalk on the phonetake out the rubbishhang out with friends...

CHAPTER 8 2025-04-29

103 Items: ADDONLYTIMEONLYALSOWHENPLACETHERELIMITMEANSREALLYDEGREEREALLYMANNERBY-CARPROVIDEPROCESSFRANKLYHOWLONGSTANDINADJUNCTSNEGATIONFOCUSINGLIMITERSSLIGHTLYLOCATIONHOWOFTENPROFORMSVIEWPOINTYESTERDAYDISJUNCTSCONJUNCTSTHEREFOREAFTERVERBADDITIVESINTENSITYCAREFULLYDIRECTIONEMPHASIZEADVERBIALSAFFECTEDBYPERIPHERALAMPLIFIERSCOMPLETELYDOWNTONERSINSTRUMENT...

DII - Komm mit! K2-2 2025-12-04

23 Items: choresto dustat hometo cleanto vacuum(to) hometo go shoppingto mow the lawnto make the bedto set the tableto watch a movieto polish the carto wash the dishesto clear the tableto dry the clothesto wash the clothesto iron the clothesto go to the moviesto go into the cityto water the flowersto take out the trashto help in the kitchen...

trs23 ie3 u6 p1 2023-01-31

12 Items: A small city.A place to swim.A place to watch movies.A place to walk and run.A place to buy fresh food.A place to leave your car.A place to learn and study.A place to sit down and eat.A place to send a letter or box.A place to read and borrow books.A place to travel to another city.A place to buy lots of different things.

The Circuit 2025-11-13

11 Items: to getperiod of timeto discover or noticethings owned by someonefarm where grapes are grownbuilding where a car is keptthe leader of a group of workersin a slow or nervous way, not sureto enjoy something for a long timea path already set and goes from one place to the nextto place items in bags, suitcases, or boxes to move them

Police Call Type 2023-11-28

20 Items: Someone broke into my barn.Someone broke into my house.There is a snake in my living room.There are dogs loose in my neighborhoodMy 14yo did not come home from the movies.I need to report an alarm from a business.My ex said he was going to come beat me up.There is a large piece of metal in the road.My 24yo daughter did not come home last night....

trs23 ver3 u13 2023-05-31

10 Items: Lions can run ___.Look ___ the window.A shape with no corners.Something not from Earth.A car has 4. A bike has 2.Cars, trains, buses, planes etc.A kind of small animal with a long tail.It is white or grey and it is made by fire.It has wheels but it doesn't drive on the road.How you feel if someone says "Boo!" behind you.

Brand Search 2025-07-23

19 Items: Which brand says “Have It Your Way”?Which brand’s logo features a swoosh?What brand uses a bitten apple as its logo?What brand uses an arrow from A to Z in its logo?What brand was represented by a light blue bird logo?Which brand uses the slogan “Because You're Worth It”?Which coffee chain has a twin-tailed mermaid as its logo?...

Transportation 2026-04-27

3 Items: hot air balloon 2 yacht 3 tram 4 motorbikecable car 6 cruise ship 7 hovercraft 8 undergroundscooter 10 helicopter 11 coach 12 ferry 13 aircraft

car 2024-10-04

1 Item: car

Car 2026-02-05

1 Item: car

Memory Word Search 2025-09-13

19 Items: A TV ShowA Dairy CowA Gem StoneA Rail SidingA Month in Springwhat trains run onBirthday Boys NameSinger of True BlueYamaha AG100 is whatTransport Gangers DroveSinger of Pub with no beerModel of car made by HoldenWhat number birthday is thisWinner of State Of Origin 2025Nail used to hold down rail lineHow many stars on Australia flag...

Spirit: Word Search 2026-06-20

13 Items: very tiredvery scareda Greek godsoft and kinda country in Europevery old and from historyto feel sorry for someonename of the 7 sisters starsan invisible part of a persona family member from a long time agothe name of the Greek hunter who chased the sistersa made up story that explains how the world was created...

The car word search 2025-10-11

2 Items: f1anticonstituellement

Secret Santa 2025-11-23

9 Items: Who has ridden an ostrich?Who tried to free a captive?Who is the richest according to Bailey?Who proposed after a splits competition?Whose first car was as old as they were?Who's name have you drawn for Christmas?Who made the most memorable green bean casserole?Who can't hum a song if they don't know the lyrics?...

Jag, Word Search 2023-04-08

1 Item: jaguar, car, loud, fast, car, dad, jag, jaguar, loud, fast, car, dad, jag, car, loud, fast, dad, jaguar

Ruber Word Search 2024-06-06

10 Items: U need to ask the teacher a...She is...a letter to her friendSomething to erase your mistakesYou write with...on a whiteboardYou glue things together with...In class we have to...our teachersI just broke my car. Can you repairMy father has a passion for footballyou write on a...with chalk in the class...

Our story 2026-02-02

10 Items: Our favorite activityMy first gift from youOur first trip overseasThe month we made it officialThe day I knew that I loved youThe bar we had our first date atThe place we met for the first timeThe trip we when on after breaking upThe name of the boy that I love so deeplyOur current favorite song to jam to in the car

Local Word Search 2026-01-04

15 Items: a ball of airmore than twoto ride a bikemade from plantsallowed by the lawnear where you livea desert animal with a humpto risk money to try to wina container used to boil watera long passage under the groundto go from one place to anothera woodland animal that eats nutsawake at night, asleep in the dayyou travel in it like a car or bus...

Past/Present Tense 2025-05-07

12 Items: I wish I _____ my cookie.The car has been ______ up.I watched my Dad as he ______.I ________ all of my homework.I got a new dress which I _____.Yesterday I went home and ______.We ______ to the Ice Cream Store.I ______ my grandmother make cookies.I have ______ to him about the problem.She _____ if I could come to her house to play....

Prefix SUPER 2026-03-23

10 Items: Someone who is very strongEyes that can see very farA car that goes incredibly fastA loud sound that shakes the roomA power that is amazing and magicalA jump that goes really, really highA mood when you feel extremely happyA place where you buy food and snacksThis person saves the world and wears a cape...

2000s Decade 2026-05-14

9 Items: The movie was released in 2000In 2007 what was released by AppleWhat invention was launched in 2006This social media was launched in 2004In 2006 what Nintendo console was releasedIn 2008 who released its Chrome Web browserIn 2005 this was launched with its first video2001 the first hybrid car became available worldwide...

Easter 2023-04-08

1 Item: jag, car, blue, white, car, jaguar, jag, loud, fast, dad, jag, jaguar, car, loud, blue, white, fast, car, loud, dad

AUTO 2025-11-14

10 Items: stop your carto pressurize refrigerantfan to circulate the cooled airto remove moisture and impuritiesto cool and liquefy the refrigerantto absorb heat and cool the cabin airvalve (or orifice tube) to regulate pressureare the suspension parts that connect the control armsare small rubber or polyurethane components that provide cushioning...

Jen Trivia: Word Search Edition 2023-07-10

25 Items: Jen's majorHer last nameHer first nameHer middle nameA sport Jen playedA sport Jen playedJen's Favorite foodJen's Favorite colorJen's Favorite animalThe name of Jen's carOne of Jen's DIY PhasesOne of Jen's DIY PhasesOne of Jen's DIY PhasesJen's favorite video gameJen's favorite soft drinkJen's favorite/lucky numberThe high school Jen attended...

TS 1 2025-09-20

80 Items: BUGREDNOWEGGCARFLYWOODHAZEGAMELIVESONGGREYSWIFTHONEYLOVERPOETSKARMASPACEBETTYRINGSBLOODSTYLEAGAINSTORYHORSEWOMANTAYLORTAYLORFIGURELUXURYLIGHTSORANGESTREETSTRINGSUMMERWILLOWMAROONMCGRAWGUITARAUGUSTBENSONBUTTONOPHELIAOPALITESPARKLESHOWBIZMASTERSSHOWGIRLDAUGHTERROMANTICWISHLISTILLUSIONFOLKLOREEVERMOREFEARLESSTHIRTEENBLACKDOGTOO WELLCARDIGANMARJORIE...

Around Town 2026-01-12

10 Items: A tall buildingA place you can borrow booksA place you can park your carA place people store their moneyThe place you go to take the busSomething you use to find your way aroundA place where you can ride a rollercoasterA large square with many different sellersA place you go to practice different sports...

uwu 2019-06-11

115 Items: aIasatbebydogoheifinitactaddageagoairallandanyarmartaskbadbagbarbedbigbitboxboybuycancarcupcutdaydiedogeatfarforgasgetherjobablealsoareaawaybabybackballbankbasebeatbestborncallcardcareeasyedgegoalheadhelpaboutaboveadmitadultafteragainagentagreeaheadallowalonealongamongapplyargueavoidacceptacrossactionaffectagencyalmostalwaysamountanimalansweranyone...

Branding 2023-12-29

14 Items: a car horse?computer makera green mermaid2 all beef pattieswhere astronauts train?no trains, but sandwichesused to be called Facebooka fruit that makes a phone?bulls eye with no merchandiseit’s a company, not a verb to make copiesa ruined social media app now called ‘X’ (lol)a soft drink that may or may not have contained cocaine...

hannah’s faves! 2025-11-04

9 Items: a car driven by two brothersthey’re not zombies, they’re …an animal with a long appendagethe middle name of the winter soldierthe first track on horan’s third albumwhat lindsay lohan plays in parent trapa slash ship from a show set in los angelesthe main character in a book you might’ve read in school...

Jenna & Spencer OO 2024-10-14

25 Items: grooms siblingbrides siblingbest mans namegrooms car colorbrides middle namegrooms middle namegrade Jenna teachesmonth groom proposedcolor of grooms eyesgrooms birthday monthbrides college mascotbrides favorite colormatron of honors nameschool Jenna teaches atcity the couple lives inmother of the grooms namemother of the brides name...

Ali Word search 2025-03-22

115 Items: hecatdogAliCarsowairgasloglionAsmaTacolookclueformdealkinglendmythholemegabellcaveloopfinearchrankblowpawnpasszebrahippoAabanAayanRabiaBismaPlaneshakevalueyoungsmallstingstandslumpstudymeritleashstateagenttempthousetitleaspecteffluxdealeranimaladmiresecurepastelexceedregretextendbuttonassumeappliedhaircutstudentpyramidconfuseimpoundapprovehostile...

Most Common Words That Start With C Part 1 2025-05-02

119 Items: cancapcarcatCEOcakecallcampcardcarecasecashcastcellchefchipcitecityclubcluecabincablecarrycatchcausechainchairchartchasecheapcheckcheekchestchiefchildcivilclaimclasscleanclearclimbclockclosecloudcameracampuscancercarboncareercenterchancechangechargecheesechoicechoosechurchcircleclientclinicclosercabinetcapablecapitalcaptaincapturecarefulcarrier...

Sip and Search 2025-07-09

20 Items: City Noah was bornNoah's middle nameJordan's horses nameWhat colour is BadgerColour of Jordan's carJordan's astrology signJordan's favourite ciderJordan's favourite flowerNoah's favourite activityNoah's favourite videogameWho lives with Noah & JordanWhere did Noah & Jordan meetWhere Noah proposed to JordanJordan's favourite warm drink...

RTC Employee Word Search 2026-03-06

14 Items: Ashlie's dogMichelle K. catScott M's classic carTrisha's newfound hobbyJennie's favorite flowerAustin does this as a hobbyThis employee has six sistersScott G drives this color vehicle.Nicole C. is training for this eventRides his bike to work rain or shineJeremy is due to have his ________ child.This manager has wooden toys in their office....

Bach 2023-04-25

93 Items: bwvcarcatdogowlpigsuntopbachballbearduckfarmfishharphornjokelamplionpetsponybirdsbunnychaseclockclownflutefuguehorselaughmarchmousemusicorganpianorikkirobotscarytruckafraidchordscreepydragonfarmerflowerjokingminuetmonkeymurrayrabbitrhythmrobotsscaredspookyanimalsballoonbaroquechasingchickenkineticmusicaloctopusroostertoccataballoonschickensdinosaur...

Michael Word Search 2025-01-29

22 Items: His dream carRob's occupationHis favorite songRob's middle name?City Rob was born in?Rob's nickname for JudyNickname he calls Haley?High School Rob attendedRob's mother's first nameColor of Rob's VolkswagenFavorite food on the grillFavorite relaxing past-timeThe number of tattoos he hasFavorite food that Mike cooksRob's favorite form of exercise...

Transport 2026-02-18

20 Items: A beautiful, expensive boat.A large animal that people can sit on to travel.A vehicle with two wheels and a powerful engine.A small bus that usually has about 8 to 15 seats.A large, strong vehicle used for carrying heavy things.A comfortable bus used for long journeys between cities.A very large boat used for traveling across deep oceans....

How well do you know me? 2025-03-28

23 Items: My last name?My eye color?Dogs or cats?Marvel or DC?My first name?My middle name?My sisters name?My schools name?My favorite color?My favorite season?My favorite animal?My 1st brothers name?My 2nd brothers name?Month of my birthday?Sport I used to play?The day of my birthday?What number car am I on?Where was our first date?...

Simple Present Word Search! 2025-04-19

20 Items: My aunt ______ to work.It ______ a lot in April.His mom ______ dinner at 6.I ______ breakfast at 7 a.m.Her cat ______ on the couch.The dog ______ at strangers.We ______ movies on weekends.Your sister ______ very well.You ______ to school every day.Tom ______ math in the evening.They ______ soccer after school.The teacher ______ on the board....

7th Energy Word Search 2025-11-18

21 Items: Stored energyBall on a hillEnergy in motionFossil fuels, foodEnergy through heatSpring or rubber bandCurrents in a circuitStored in the nucleusCar moving, skateboardPart that is being studiedMovement of thermal energyHeat transfer through fluidsEverything outside the systemHeat transfer through direct contactLight, electromagnetic waves from sun...

Travel (Medium) 2026-01-17

25 Items: Jet lag causeBag for travelViewpoint spotBag worn on backVisit to exhibitsChain of mountainsGetting directionsTicket for a flightPlace trains arriveRegional food styleBoat ride at sunsetLong walk in naturePlace flights departGuided route on footFalling river featureProtected nature areaPlace to buy memoriesReservation for a stay...

Open House Word Search 2025-07-01

16 Items: Where do you play?Where do you sleep?What has eight sides?Where do you eat meals?What is made from trees?Where meals are prepared?Where do you park your car?What is soft but stepped on?What's the Agent's last name?Where do you store your food?Where is the best place to be?What's the Agent's first name?What holds your plates and cups?...

Prepare 4 2025-10-12

11 Items: vey bigvery badvery tiredvery smallcalm and not busydifficult to think it's trueto go away from someone or somethinga young person between 13 and 19 years oldto leave your job or stop working because of old age or ill healtha written message from one person to another, usually put in an envelope and sent by post...

Roller coaster 2025-04-17

11 Items: gravityany push or pullgravitationconstanthow fast something movesa force that draws to eachotherThe energy of an object in motionThe force exerted on an object by the Earth'sThe energy stored by an object ready to be usedA force caused by a rubbing motion between two objects.A combination of speed and the direction in which an object travels...

Girlfriend Trivia 2025-12-22

10 Items: my dog that loves youwhat month is my birthdaygolf our first date activitywhat color was my hoco dresswhat did I dress as for halloweenare you going to let me drive your car;)what we resisted doing at the Elf Musicalwhat color are my eyes... its also our fav colorthe restaurant I introduced you to that you now love...

IRREGULAR VERBS, CAR/GAR/ZAR, BYE BYE I HELLO Y 2020-09-17

5 Items: irserdarverbuscar

Jobs vocab 2026-06-01

13 Items: Tom Cruise is oneTaylor Swift is onea cook in a restaurantwhen you need your hair cuta person who draws or paintsthe look after sheep and cowsthe person flying the aeroplanif there's a fire you call themthe person you see when you are sicka person in uniform that can help youthe help doctors and work in hospitals...

Car Word Search 2025-01-16

1 Item: CAR

Transportes 2025-10-02

1 Item: CAR

Vocab- H 2025-08-22

10 Items: It gives light when it’s dark.You put books or objects on it.A place where you park your car.You walk on this inside a house.A table where you study or work.You look at your reflection in this.A soft floor covering made of fabric.A big chair where many people can sit.You walk up or down on these to change floors....

Spelling 4 2024-03-27

10 Items: accurate, not falseto press against with forcepart of the body on the handa raised platform in a theatercreate a picture using a writing utensilanother word for car; short for automaticgive or hand over something in exchange for moneyhaving or showing a high degree of mental abilitya hint or piece of evidence that helps with the answer...

STUFF 2023-04-03

9 Items: your paycheckI want my payI bought a carI have so little moneyI got 1 gummy and you got 1 gummyCanada just sent us a lot of syrupI got this for 2 dollars here when it was 5 at WalmartI bought this for 10 dollars but I got 20 dollars for itand demand I only have 10 of this but 20 people want it

Transp 2025-10-02

1 Item: Car

Ens 2023-03-06

1 Item: car

Car Word Search 2026-03-17

1 Item: car

Car Word Search 2025-08-15

1 Item: Car

Words You Know 2026-03-13

15 Items: You do this sportYou like this foodYou go here to studyYou use this to drinkYou can go places in thisYou did this at PancasonaThis is your sister's nameYou eat this in the morningThis is someone you play withYou get this on your birthdayThis animal is black and whiteThis is the country you come fromYou put your head on this at night...

Words You Know 2026-03-13

15 Items: You do this sportYou like this foodYou go here to studyYou use this to drinkYou can go places in thisYou did this at PancasonaThis is your sister's nameYou eat this in the morningThis is someone you play withYou get this on your birthdayThis animal is black and whiteThis is the country you come fromYou put your head on this at night...

Into the Wild Ch 4-6 Review 2024-11-05

15 Items: Made this with Ron ________Ron offers to... _________ ________Abandoned his car here __________ _______Where Chris worked in Arizona ____________Where Chris met Ron ___________ ___________Chris hated this item of clothing _________Chris described him as a lunatic __________Where Chris went on his canoe trip __________...

Spanish 37 2023-04-17

33 Items: roomgarageto livekitchento helpto cookto givefar frombathroombasementapartmentdiningroomhome officethird floorliving roomstory, floorground floorsecond floorclose to nearto cut the lawnto feed the dogto make the bedto wash the carstairs, stairwayto set the tableto wash the dishesto wash the clothesel polvo to dustto clean the bathroom...