car Word Searches

Nightlight Word Search 2025-11-02

100 Items: seatTronCunaCribMamiPapiNiñoQuiltWipesOsitoStorkMommyDaddyMantaSwingMóvilBrushDreftMobilBaberoMoisésLociónRattleWalkerPijamaCorralPajamaFormulaPañalesChupeteTeetherDiapersPampersCigüeñaSwaddleLullabyBotinesGrandpaPatucosBootiesAndadorBlanketMonitorBouncerDesitinCepilloOnesiesBathtubGorritoPlaypenStrollerPacifierMordedorBassinetMecedoraColumpio...

Daniels Birthday! 2026-02-25

100 Items: WetDRSERSCarHaasAudiSoftHardDragAeromodeApexChinaJapanMiamiItalyQatarFloorTyresMotorCanadaMonacoMadridMexicoBrazilAlpineMediumPodiumDunlopGarageRacingBahrainAustriaBritishBelgiumHungaryMcLarenFerrariRedBullCornersBatteryOvercutHairpinBallastCockpitLasVegasAbuDhabiMercedesWilliamsCadillacOvertakeRechargeMaggottsBeckettsLuffieldCompoundDiffuser...

Water Word Search 2026-03-13

101 Items: orushowdidmanwhorancatneweatourtwohasyesdogfoxwayredseaboybedmaysaycarawaygoodwantovertookhomeknowbearlongplaytakewellfindmoreI’lltreefoodbeenstopmustdoornextworklotsneedbabyfishgavelivesoonheadkingtownI’vewatergoingwherewouldthinkcan’tagainafterroundmagicotherrightthesebeganneverfirstmousestillfoundnightsmallthreeeveryUriahschooldidn’tthingswanted...

Random 2026-04-02

96 Items: bedboxboycarcatcowdaydogeggeyelegmanmenpigsuntoptoywaybabybackballbearbellbirdboatcakecoatcorndolldoorduckfarmfeetfirefishgamegirlgoathandheadhillhomemilknamenestrainringseedshoesnowsongtimetreewindwoodapplebreadchairfloorgrasshorsehousekittymoneynightpaperpartyrobinClaussheepsticktablethingwatchwaterwomanfarmerfatherflowergardengroundlettermother...

Monthly Challenge C-D 2023-03-09

102 Items: cancarcatcowcrycupcutdaddaydogdrycakecallcardcarecavecityclapcluecoatcoldcomecookcoolcopydarkdeardeepdeskdolldoordowndrawdropdrumduckcarrycatchcausechairchantcheckcheerchildclasscleanclearclimbclockclosecolorcouldcountcovercrosscrowddancedirtydreamdressdrinkdrivecameracannotcastlecenterchancechangecheesechoosechoruscirclecookiecoursecrayoncreate...

Apple Word Search 2025-02-17

100 Items: UpInGoNoCatDogEggHatIceSunVanSadBigHotOutYesBagHatCarBusRunEatCryBallFishGoatJumpKiteLionMoonNestRainTreeFastSlowColdDownLeftOpenStopLoveHomeBookDeskDoorCoatBoatWalkSingReadDrawCookPlayHelpApplePandaQueenWaterYo-yoZebraHappySmallRightCloseThankPaperChairClockShoesSocksShirtPantsTrainPlaneClimbDanceWritePaintDrinkSleepDreamLaughSmileWatchShareBuild...

Random 2025-05-22

100 Items: tworotdogpettowcarearhillsealbuzzpinkratesoftlampbootpaildampwhipbathlushtestbumpgoldstovescentteaseblinkpsychcoachdelaystalenuttycrossqueueframedressplanttwistclassequalstarttablebumpysoundstrapblackghostelbowchasefilthysmoggyamountbreathnormalcrayoncaringscaredattachturkeybeliefwobblechurchhobbiesfertilecuriouscallousrailwayloutishevasivepitched...

Time Word Search 2025-09-18

100 Items: waydaymanloteyejobendlawcarkidartwarguyairtimeyearlifehandpartcaseweekworkhomeroomareafactbookwordsidekindheadhourgamelinecitynameteamideabodybackfacedoorgirlthingwomanchildworldstategroupplacenightpointwatermoneystorymonthrightstudyissuehousepowerlevelpartyforcepeopleschoolfamilysystemnumbermotherfriendfathermemberminuteparentothersofficehealth...

Jobs - Network 2 2026-01-21

20 Items: Cut hair.Write booksSing songs.Repair cars.Sell products.Help students.Travel to space.Fly an aeroplane.Perform in films.Create companies.Play an instrument.Show places to people.Wash the floor and walls.Cook food at a restaurant.Make paintings, statues, etc.Take care of people in hospital.Serve customers at a restaurant....

Ted Bundy Word Search 2024-09-16

10 Items: Ted Bundy's childWhat Ted Bundy wasTed Bundy's full nameHis first known victimWhere Ted Bundy was bornWhere Ted Bundy's car is nowWhat he would do to his victimsHow many women he confessed to killing.Ted Bundy faked these to lure his victimsThe biggest piece of evidence that led to his arrest

Grandpa's Favorite Things 2025-03-02

29 Items: What you call DJKelly's nicknameYour favorite carWhat DJ stands forWhat you call KierstinYour branch of serviceShe who throws shot putShe who is in show choirWhat you make in microwaveShe who works for the stateWhat grandma calls KierstinShe who cuts and styles hairYour favorite frozen dessertHe who owns a car repair shop...

Steve and Becki 2026-04-10

34 Items: The bride's first carThe groom's shoe sizeThe groom's first carThe bride's middle nameThe groom's middle nameThe bride's first schoolGrooms favourite TV showThe groom's coffee orderThe groom's sporting iconThe couple's favourite bandThe month the groom proposedThe couple's favourite storeThe bride's favourite colourThe bride's favourite tipple...

Jacob's Word Search 2015-02-07

96 Items: AmAsAxBeGoIsItOhTvUpWeAndAntBagBeeBenCanCarCatDadDanDogFanFigFinForFoxHamHatHenLetMadManMomOffPotRugSadTabTheVanWonZooBedsCrowDirtDiveDuckEvenFastFishFlatFoodiPadLegoLionMadeRaceRockSackSandShipShowSledSnowSockThatWereWhenAppleBeastCraneEagleHandyMagicNeedsOceanPowerQuackQuestQuillQuiltSmileStickStingTruckWaterAlwaysBananaBusterElevenHeroesStrong...

Veda's 100 Days of School 2025-01-26

100 Items: IAnAsAtBeByDoGoIfInIsItNoUpAllAndAntAreArmAshAskBatBigBitBugButCanCarCatCotCupCutDadDidDogForGetHadHasHerHimHisHotHowHutLegManMatMitMomNutOutRagRanRugRunSamSatSisSitTagTheTomWasYouAwayBallCallDollDownFindFromHereIntoJustLikeLongLookLoveMallNestOntoStopTallThatThemThenTheyThisVedaWallWellWhatWhenWillWithYourHappyQuinnAlmeida

Vwo 1: Unit 3 2025-03-12

100 Items: CARSADBIKECAKECALMCITYDATEFAREFASTFLATHOMEHOSTHUGEKINDLIFTMEANMOVERIDERUDESAFESITESLOWTALLTAXIWAITBOREDCHEAPDELAYENJOYFERRYFUNNYPARTYQUITESCARYSHARESPACESTORETIREDUPSETVISITWHILECHURCHDRIVERHEIGHTMOSQUEMUSEUMSCAREDSTATUESUBWAYTEMPLETICKETTRAVELBICYCLECOMMUTECOSTUMECROWDEDEXPLOREHOSTESSIMAGINEJOURNEYMESSAGERAILWAYRELAXEDSTADIUMTAXICABTHEATRETRAFFIC...

SP2L5 El Carro 2025-04-23

32 Items: carGPShoodtiretrunkstreetgaragepolicehighwayhighwaytrafficto parkto stopfinallygasolinemechanicto crankto drivewindshieldgas stationspeed limitaround herefor examplesteering wheelauto repair shopdriver's licenseto fill the tankto check the oilto fix; to arrangethat's why; thereforeto get on/into (a vehicle)to get off of/out of (a vehicle)

Time Word Search 2025-04-28

100 Items: waydaymanloteyejobendlawcarkidartwarguyairtimeyearlifehandpartcaseweekworkhomeroomareafactbookwordsidekindheadhourgamelinecitynameteamideabodybackfacedoorgirlthingwomanchildworldstategroupplacenightpointwatermoneystorymonthrightstudyissuehousepowerlevelpartyforcepeopleschoolfamilysystemnumbermotherfriendfathermemberminuteparentothersofficehealth...

Christmas 2025-11-15

100 Items: ARTARMANTCARCUPDOGEGGEYEFANFOXHATICEINKJARKEYBIRDBOATBALLBOOKCOOKCAVEDOLLDOORDESKDEERDUCKFISHFROGFIREGATEGIFTGOATGAMEHANDHILLIRONIDEAJUMPKITEKINGKNEELAMPLEAFLAKELIONLINELOCKLOVEAPPLEACTORANGELAWARDBRAINCLOUDCHAIRCANDYDREAMDRESSEARTHEAGLEFRUITFENCEGLASSGLOVEGRASSHOUSEHORSEJUICEJEWELLIGHTLEMONANIMALAUTUMNBOTTLEBANANABASKETBUTTONBRIDGECANDLECIRCLE...

Word Search 2025-12-02

100 Items: SkyDogCatCarSunTeaIceArtGymTreeStarFireLeafBookDoorBirdFishMoonRainSnowWindSandRockSoilSeedMeatMilkSaltSoupCakeFilmGameTeamMallCityTownAppleRiverOceanCloudChairTableLightGrassHorseTrainStormEarthFruitBreadWaterJuiceSugarSpiceSauceSaladCandyMusicDancePaintColorSportCoachFieldCourtClassStoreWorldWindowShadowFlowerRocketPlanetCoffeePepperCookiePlayer...

Daniels Birthday! 2026-02-25

100 Items: WetDRSERSCarHaasAudiSoftHardDragAeromodeApexChinaJapanMiamiItalyQatarFloorTyresMotorCanadaMonacoMadridMexicoBrazilAlpineMediumPodiumDunlopGarageRacingBahrainAustriaBritishBelgiumHungaryMcLarenFerrariRedBullCornersBatteryOvercutHairpinBallastCockpitLasVegasAbuDhabiMercedesWilliamsCadillacOvertakeRechargeMaggottsBeckettsLuffieldCompoundDiffuser...

Ohana Word Search 2026-03-11

7 Items: Enjoy dinner in a carTravel back to Colonial timesMind your manners in this 1950s kitchenWatch fish, sharks, turtles, and rays swimWatch the monorail come and go while you eatAn immersive, family-style Polynesian experienceThis is where I learned the history of the sandwich

Boat Word Search 2023-04-21

100 Items: eyepigdaytoycatwaycarsunboxbedegglegboycowtopdogmanboatfootnameseedbellheadballcakedollsongbabyhillbearduckrainstarbathdoorbookcoatfirenestmilkcornfishshoetimehandringwindgamebackgirlhomesnowtreebirdfarmwoodmoneytablerobinhorsewatchbreadpartysmilekittygrasshousewatersheepthingbirthnightchairstickapplefloorpaperchildClausstoryletterstreetwindow...

Language Cafe Word Search 2024-07-18

80 Items: 你好再见谢谢是的nono食物帮助朋友家庭房子汽车学校早上夜晚youyesouieauamicarcatdogholaneinaguafoodcibohelpaidelovecasaautobookgatochathundcanehellofavordankewateressenayudaliebeamoreamigohouselibrolivrematinnightnachtnottepleasegraziefriendfamilymaisonschoolschulescuolamañanabonjourgoodbyefamiliemorningfamigliamacchinavous plaîtWiedersehenarrivederci

road trips 2025-04-21

101 Items: cargasiowaohioutahtriprainfuelidahomainetexasstateroadshillsparkshoteltollsmusicradiosunnystormwindytreesalaskahawaiikansasnevadaoregandesertforestplainsplatestravelmilagesnackshikingbreaksalabamaarizonafloridageorgiaindianamontananewyorkvermontwyomingmidwesttornadocanyonsbordersdrivinglicensecampingpackingluggageweathertraffichighwayarkansas...

Dolch nouns 2025-09-30

95 Items: bedboxboycarcatcowdaydogeggeyelegmanmenpigsuntoptoywaybabybackballbearbellbirdboatcakecoatcorndolldoorduckfarmfeetfirefishgamegirlhandheadhillhomemilknamenestrainringseedshoesnowsongtimetreewindwoodapplebreadchairfloorgrasshorsehousekittymoneynightpaperpartyrobinClaussheepsticktablethingwatchwaterfarmerfatherflowergardengroundlettermotherrabbit...

Unit 4 2026-02-10

38 Items: qù, go tozero (líng)two (liǎng)qì chē - carminute (fēn)wǔ faǹ,lunchnow (xiànzài)jǐ - how manyzǒu lù to walkfēi jī - planeo'clock (diǎn)huǒ chē - trainwaň faǹ,dinnerchuán - ship, boatshang̀ wǔ, morningzaǒ shang̀, morningzaǒ faǹ, breakfastfall short of (chà)měi tiān - every daydì tiě subway; metrowaň shang̀, eveningto sleep (shuì jiào)...

I Love You 2026-04-16

19 Items: Your carPray TellLittle manMinion StimYour streetYour #1 movieDrink you likeYour fav colorOrder at paneraRio...no elaboratingBaby/Family nicknameMy baby at your houseNickname I have for youFirst drink in the morningWhere we had our first dateSomething we always eat at homeState you drove to for your wheelsFirst city we travelled to together...

LANGUAGE BUILDER 2024-04-07

19 Items: Toà nhàVăn phòngQuầy lễ tânNhà vệ sinhOpposite to nearOpposite to leftOpposite to openOpposite to fullOpposite to earlyOpposite to largeYou buy medicine hereWhere you play sportsYou park your car hereYour money is safe hereYou can buy anything hereATM is another term for thisYou send letters, parcels here.You can read or borrow books here...

Summer of the Mariposas Chapters 1-7 2025-10-15

15 Items: Mother to InesNumber of sistersLeader and narratorOdilia's magical itemThe baby of the familyThe dead man's first nameSpanish for "butterflies"State where the girls liveMama's job is a __________Country the sisters travel toMythical creature guiding the girlsAnimal that symbolizes transformationFavorite game played by the Garza family...

Car Word Search 2025-01-23

1 Item: car

June & Char 2026-01-27

9 Items: Where did we first meet?Where was our first kiss?Where did you ask me out?Name of stuffy you first got me?Symbol of bracelets I first got us?Favorite thing to say to each other?First iMessage game we played together?Where would we always hang out during school?Favorite thing we used to do at school at night?

/r/ Production Practice 2024-09-29

10 Items: The race is "ready" to start.The "rose" is "red" and nice.The "rabbit" was running away."Robots" are really fun to see.The road was in a "remote" area.The "raven" was watching the ride.The car was "racing" down the road.He loved to "read" about the "rings"."Rough" conditions stopped the rescue.The wind was "rapidly" making a rotation.

Kenny’s Great Big Word Search! 2026-02-13

10 Items: Your car name“Will you be my…?”Your favorite colorYour favorite artistYou say this word a lotYour (OUR) school mascotOur favorite meal to cook together“You make me feel like I’ve been locked out of…”Where I had Indian food with you for the first timeThe name of the cafe we had our first date location in Oxford

Latin word search 2025-12-09

15 Items: in the areastarting a fireto give to someonesomething being wonsomeone who has wonfleet of weapon shipsa gift toward someonebeing a representativeif you support your causeif you are worthy you havenot understanding out of spitestarting a spark to start a carplace where the weapons are heldgroup of people that fight for a thing...

June & Char 2026-01-27

9 Items: Where did we first meet?Where was our first kiss?Where did you ask me out?Name of stuffy you first got me?Symbol of bracelets I first got us?Favorite thing to say to each other?First iMessage game we played together?Where would we always hang out during school?Favorite thing we used to do at school at night?

Word Search #1 2025-07-03

13 Items: Where do you play?Where do you sleep?What has eight sides?Where do you eat meals?What is made from trees?Where meals are prepared?Where do you park your car?What is soft but stepped on?Where do you store your food?Where is the best place to be?What holds your plates and cups?What takes you from point A, to point B?...

June & Char 2026-01-27

9 Items: Where did we first meet?Where was our first kiss?Where did you ask me out?Name of stuffy you first got me?Symbol of bracelets I first got us?Favorite thing to say to each other?First iMessage game we played together?Where would we always hang out during school?Favorite thing we used to do at school at night?

Idioms and adjectives to describe feelings 2024-12-10

12 Items: Before the exam results came out, I was on edge.When I heard that I got the job, I was over the moon.When she saw her friend's new car, she was green with envy.After trying to explain it five times, I was at my wit's end.She's been down in the dumps after her best friend moved away.She was scared stiff when the roller coaster plunged downwards....

yuleysi's word search 2023-03-03

20 Items: sky colorfeel goodgrass colora dark colorbrown personyour moms momfixes your carcuts your hairwhat you see withyou use it to talkwhen you feel downyou drink to hydratewhat people call youthe color of the sunmexican eat them a lotsomewhere you go to learnyou eat it a lot in the summersomething healthy besides veggies...

Saffron and Ashley OO 2024-09-17

25 Items: Groom hobbyMonth we metGroom hometownGroom Star SignBride star signBride eye colourFlower girl nameBride birth monthWhere did we meetGroom Middle nameBride middle nameGrooms high schoolNumber of best menMonth of engagementPlace of engagementMost recent concertMother of Bride nameMother of groom nameGrooms favourite carCouples first holiday...

Viajes 2025-11-11

46 Items: RVcarbuscitylakeboatriverruinscabinplanetrainmuseumislandforestdesertto skicastletempleticketcameracruiseflightvolcanoto hiketo rideto swimto stayto packto camppyramidto floatto relaxto visitsouvenirpassportsuitcasemountainsto travelcathedralwater parkto explorecountrysideto sightseeto scuba divenational parkamusement park

My first 50 words 2023-02-14

50 Items: unoaguataximesarojovidacasaniñacafégatoniñoazulcamamujerfaldaaviónplumahotelamigoperrorelojsillacochenegrobolsoángelinglésblancoshortsdinerohombrecomidabailarciudadlibroszapatosnaranjavestidobotellamanzanaamarilloparaguasnoticiaschamarraenfermeraluz/ligerohamburgesacocinero/chefcompañeros de clasepantalón de mezclilla

Spanish recap 2023-07-20

30 Items: a cara busa beda farma towna citya housea coacha tablethe poola windowI live ina cottagethe beachthe atticby the seathe churchthe cinemato sunbathethe kitchenan aeroplanethe water parkthe theme parkto the left ofthe post officeto the right ofthe living roomthe dining roomto swim in the seathe shopping centre

Review Words Level 1 2024-07-19

103 Items: axoxupantbedcatcupcardogeggfanhatdoginkjetjamkeynutnetpensunvanvetwebfoxboxsixwaxyakzoobearbirddeskdollduckfishfarmforkgoatgiftgirlkingkitelionlampleafmilknestnosequizrosericesealsoaptentvestwolfzeroappleelbowhorsehouseigloojuicelemonmouseolivepeachpandaqueenquiltrobotsockstigerunclewaterwatchyo-yoyachtzebrabananainsectiguanajacketmonkeyrabbit...

Bank Accounts and Terminology 2025-06-21

21 Items: VISA$19 feeLoan for a CarRetirement planLoan for a HouseNo minimum balanceCredit for a HouseType of InvestmentSignature Guarantee$5 to keep account openMinimum balance of $2500Educational Savings PlanTotal Amount of InterestType of Overdraft ProtectionAnnual Cost of Borrowing MoneyMonetary Instrument with $3 feeMonetary Instrument with $5 fee...

Our own 2026-03-29

35 Items: readreadplayselfdrivecatchtrackspeedsnailstudystrongnova isdance taplast nameI love youvideo gamelift heavyour schoolDaddy's sonhappy danceflip on barwe are happyplace to learnto talk to godlove seeing itDaddy's daughterGia and nova dadDaddy's computerwhat's your nameJackson musicianPettit & Stadokasomething to watchour favorite color...

Christmas Word Search 2022-12-22

17 Items: frozen rainSanta's carChristmas Grandpathe sound of bellssomething for a fireanother word for giftan old word for happywhat we do to the treeput the gifts under thiswhat month is Christmas?another place to put giftskids want these from Santaa treat we leave for santathey carry Santa in the skythey help Santa make the gifts...

Safety Week Word Search 2026-04-09

17 Items: G______ WalkPPE for your eyesPPE for your feetPPE for your bodyLock Out T___ OutFire E__________.PPE for your earsPPE for your handsPed Seg keeps who safer?It might be something dangerousWork Safely to Prevent an I_____.Probably weighs more than your carCall N______ Triage in an emergencyUse to clean out your eyes in emergency...

car 2024-03-20

1 Item: ferrari

Site words 1 2023-01-13

113 Items: hegoinismetoitmyweonatasofifambedonousuporcanyouseegetnotanddidrunforwasareallbigboybutcardayeatfunhadhasherhimhishownewnowoffoldoutransawshewhywhooneusetwoanysaidhavelikeawaybestcomedownfromgirlgivegoodherelookmademakeoverplaysometellthatthemtheythisthemwantwhenwhatwentwillwithyourweregirleachbeenwordmanyintodoesafteraboutcan’thousetherethingwould...

CHAPTER 8 2025-04-29

103 Items: ADDONLYTIMEONLYALSOWHENPLACETHERELIMITMEANSREALLYDEGREEREALLYMANNERBY-CARPROVIDEPROCESSFRANKLYHOWLONGSTANDINADJUNCTSNEGATIONFOCUSINGLIMITERSSLIGHTLYLOCATIONHOWOFTENPROFORMSVIEWPOINTYESTERDAYDISJUNCTSCONJUNCTSTHEREFOREAFTERVERBADDITIVESINTENSITYCAREFULLYDIRECTIONEMPHASIZEADVERBIALSAFFECTEDBYPERIPHERALAMPLIFIERSCOMPLETELYDOWNTONERSINSTRUMENT...

Taylor Swift Songs (2 Words) 2026-03-02

56 Items: ________ ItBad ________________ Man________ Bow________ BadEnd ________________ God________ One________ CarHey ________________ BoyMad ________New ________________ NewOur ________________ Fly________ NowTim ________Dear ________Dear ________________ Open________ RushHigh ________Hits ________Holy ________Last ________________ HazeLong ________...

The Circuit 2025-11-13

11 Items: to getperiod of timeto discover or noticethings owned by someonefarm where grapes are grownbuilding where a car is keptthe leader of a group of workersin a slow or nervous way, not sureto enjoy something for a long timea path already set and goes from one place to the nextto place items in bags, suitcases, or boxes to move them

trs23 ie2 u3p2 2022-11-16

10 Items: Doesn't work.It has 2 wheels.It can fly. It has wings.It's big and has 4 wheels.It can fly. It doesn't have wings.It's very big and has 4 wheels. (Br)It's very big and has 4 wheels. (US)You can see it on a yo-yo and a kite.It is round. It is on a car and a bus.Two overlapping circles with things inside.

Iloveyou Word Search 2026-02-03

10 Items: our first kissour fav icecreamwhere we first metfirst board game together"you only **** 1/3 of me??"these are growing in your backyard!i <3 early morning breakfast with you herea ray rays best friend (hint: "a mans best friend")model of car i accidentally hit in the garage freshman year...

English III 2026-04-06

10 Items: Camels live in the _________Have you ever _____ in a plane?I booked our tickets 2 days _____A bike is __________ a car (cheap)I need to know how to use a ________The garden is a mess, can you _________?He works in an office, he is a ___________why don't you ______ this local dish? (verb)I like cold weather, that's why I like ______...

My first 50 words 2023-02-14

50 Items: unoaguataximesarojovidacasaniñacafégatoniñoazulcamamujerfaldaaviónplumahotelamigoperrorelojsillacochenegrobolsoángelinglésblancoshortsdinerohombrecomidabailarciudadlibroszapatosnaranjavestidobotellamanzanaamarilloparaguasnoticiaschamarraenfermeraluz/ligerohamburgesacocinero/chefcompañeros de clasepantalón de mezclilla

Do Word Search 2023-05-17

28 Items: hooverget upget homego to bedwatch DVDsplay chesshave lunchgo shoppingget dressedhave dinnerdo homeworkwash the cartidy my roomsurf the Netgo to schoolhave a showerdo the washingread magazineshave breakfastlisten to musicbrush my teethgo to the cinemaclean the windowsdo the washing-uptalk on the phonetake out the rubbishhang out with friends...

CHAPTER 8 2025-04-29

103 Items: ADDONLYTIMEONLYALSOWHENPLACETHERELIMITMEANSREALLYDEGREEREALLYMANNERBY-CARPROVIDEPROCESSFRANKLYHOWLONGSTANDINADJUNCTSNEGATIONFOCUSINGLIMITERSSLIGHTLYLOCATIONHOWOFTENPROFORMSVIEWPOINTYESTERDAYDISJUNCTSCONJUNCTSTHEREFOREAFTERVERBADDITIVESINTENSITYCAREFULLYDIRECTIONEMPHASIZEADVERBIALSAFFECTEDBYPERIPHERALAMPLIFIERSCOMPLETELYDOWNTONERSINSTRUMENT...

DII - Komm mit! K2-2 2025-12-04

23 Items: choresto dustat hometo cleanto vacuum(to) hometo go shoppingto mow the lawnto make the bedto set the tableto watch a movieto polish the carto wash the dishesto clear the tableto dry the clothesto wash the clothesto iron the clothesto go to the moviesto go into the cityto water the flowersto take out the trashto help in the kitchen...

Police Call Type 2023-11-28

20 Items: Someone broke into my barn.Someone broke into my house.There is a snake in my living room.There are dogs loose in my neighborhoodMy 14yo did not come home from the movies.I need to report an alarm from a business.My ex said he was going to come beat me up.There is a large piece of metal in the road.My 24yo daughter did not come home last night....

trs23 ver3 u13 2023-05-31

10 Items: Lions can run ___.Look ___ the window.A shape with no corners.Something not from Earth.A car has 4. A bike has 2.Cars, trains, buses, planes etc.A kind of small animal with a long tail.It is white or grey and it is made by fire.It has wheels but it doesn't drive on the road.How you feel if someone says "Boo!" behind you.

trs23 ie3 u6 p1 2023-01-31

12 Items: A small city.A place to swim.A place to watch movies.A place to walk and run.A place to buy fresh food.A place to leave your car.A place to learn and study.A place to sit down and eat.A place to send a letter or box.A place to read and borrow books.A place to travel to another city.A place to buy lots of different things.

Brand Search 2025-07-23

19 Items: Which brand says “Have It Your Way”?Which brand’s logo features a swoosh?What brand uses a bitten apple as its logo?What brand uses an arrow from A to Z in its logo?What brand was represented by a light blue bird logo?Which brand uses the slogan “Because You're Worth It”?Which coffee chain has a twin-tailed mermaid as its logo?...

Memory Word Search 2025-09-13

19 Items: A TV ShowA Dairy CowA Gem StoneA Rail SidingA Month in Springwhat trains run onBirthday Boys NameSinger of True BlueYamaha AG100 is whatTransport Gangers DroveSinger of Pub with no beerModel of car made by HoldenWhat number birthday is thisWinner of State Of Origin 2025Nail used to hold down rail lineHow many stars on Australia flag...

car 2024-10-04

1 Item: car

Car 2026-02-05

1 Item: car

Jag, Word Search 2023-04-08

1 Item: jaguar, car, loud, fast, car, dad, jag, jaguar, loud, fast, car, dad, jag, car, loud, fast, dad, jaguar

Secret Santa 2025-11-23

9 Items: Who has ridden an ostrich?Who tried to free a captive?Who is the richest according to Bailey?Who proposed after a splits competition?Whose first car was as old as they were?Who's name have you drawn for Christmas?Who made the most memorable green bean casserole?Who can't hum a song if they don't know the lyrics?...

The car word search 2025-10-11

2 Items: f1anticonstituellement

Local Word Search 2026-01-04

15 Items: a ball of airmore than twoto ride a bikemade from plantsallowed by the lawnear where you livea desert animal with a humpto risk money to try to wina container used to boil watera long passage under the groundto go from one place to anothera woodland animal that eats nutsawake at night, asleep in the dayyou travel in it like a car or bus...

Prefix SUPER 2026-03-23

10 Items: Someone who is very strongEyes that can see very farA car that goes incredibly fastA loud sound that shakes the roomA power that is amazing and magicalA jump that goes really, really highA mood when you feel extremely happyA place where you buy food and snacksThis person saves the world and wears a cape...

Ruber Word Search 2024-06-06

10 Items: U need to ask the teacher a...She is...a letter to her friendSomething to erase your mistakesYou write with...on a whiteboardYou glue things together with...In class we have to...our teachersI just broke my car. Can you repairMy father has a passion for footballyou write on a...with chalk in the class...

Our story 2026-02-02

10 Items: Our favorite activityMy first gift from youOur first trip overseasThe month we made it officialThe day I knew that I loved youThe bar we had our first date atThe place we met for the first timeThe trip we when on after breaking upThe name of the boy that I love so deeplyOur current favorite song to jam to in the car

Easter 2023-04-08

1 Item: jag, car, blue, white, car, jaguar, jag, loud, fast, dad, jag, jaguar, car, loud, blue, white, fast, car, loud, dad

Past/Present Tense 2025-05-07

12 Items: I wish I _____ my cookie.The car has been ______ up.I watched my Dad as he ______.I ________ all of my homework.I got a new dress which I _____.Yesterday I went home and ______.We ______ to the Ice Cream Store.I ______ my grandmother make cookies.I have ______ to him about the problem.She _____ if I could come to her house to play....

AUTO 2025-11-14

10 Items: stop your carto pressurize refrigerantfan to circulate the cooled airto remove moisture and impuritiesto cool and liquefy the refrigerantto absorb heat and cool the cabin airvalve (or orifice tube) to regulate pressureare the suspension parts that connect the control armsare small rubber or polyurethane components that provide cushioning...

uwu 2019-06-11

115 Items: aIasatbebydogoheifinitactaddageagoairallandanyarmartaskbadbagbarbedbigbitboxboybuycancarcupcutdaydiedogeatfarforgasgetherjobablealsoareaawaybabybackballbankbasebeatbestborncallcardcareeasyedgegoalheadhelpaboutaboveadmitadultafteragainagentagreeaheadallowalonealongamongapplyargueavoidacceptacrossactionaffectagencyalmostalwaysamountanimalansweranyone...

Branding 2023-12-29

14 Items: a car horse?computer makera green mermaid2 all beef pattieswhere astronauts train?no trains, but sandwichesused to be called Facebooka fruit that makes a phone?bulls eye with no merchandiseit’s a company, not a verb to make copiesa ruined social media app now called ‘X’ (lol)a soft drink that may or may not have contained cocaine...

Around Town 2026-01-12

10 Items: A tall buildingA place you can borrow booksA place you can park your carA place people store their moneyThe place you go to take the busSomething you use to find your way aroundA place where you can ride a rollercoasterA large square with many different sellersA place you go to practice different sports...

Jen Trivia: Word Search Edition 2023-07-10

25 Items: Jen's majorHer last nameHer first nameHer middle nameA sport Jen playedA sport Jen playedJen's Favorite foodJen's Favorite colorJen's Favorite animalThe name of Jen's carOne of Jen's DIY PhasesOne of Jen's DIY PhasesOne of Jen's DIY PhasesJen's favorite video gameJen's favorite soft drinkJen's favorite/lucky numberThe high school Jen attended...

TS 1 2025-09-20

80 Items: BUGREDNOWEGGCARFLYWOODHAZEGAMELIVESONGGREYSWIFTHONEYLOVERPOETSKARMASPACEBETTYRINGSBLOODSTYLEAGAINSTORYHORSEWOMANTAYLORTAYLORFIGURELUXURYLIGHTSORANGESTREETSTRINGSUMMERWILLOWMAROONMCGRAWGUITARAUGUSTBENSONBUTTONOPHELIAOPALITESPARKLESHOWBIZMASTERSSHOWGIRLDAUGHTERROMANTICWISHLISTILLUSIONFOLKLOREEVERMOREFEARLESSTHIRTEENBLACKDOGTOO WELLCARDIGANMARJORIE...

Jenna & Spencer OO 2024-10-14

25 Items: grooms siblingbrides siblingbest mans namegrooms car colorbrides middle namegrooms middle namegrade Jenna teachesmonth groom proposedcolor of grooms eyesgrooms birthday monthbrides college mascotbrides favorite colormatron of honors nameschool Jenna teaches atcity the couple lives inmother of the grooms namemother of the brides name...

Ali Word search 2025-03-22

115 Items: hecatdogAliCarsowairgasloglionAsmaTacolookclueformdealkinglendmythholemegabellcaveloopfinearchrankblowpawnpasszebrahippoAabanAayanRabiaBismaPlaneshakevalueyoungsmallstingstandslumpstudymeritleashstateagenttempthousetitleaspecteffluxdealeranimaladmiresecurepastelexceedregretextendbuttonassumeappliedhaircutstudentpyramidconfuseimpoundapprovehostile...

Most Common Words That Start With C Part 1 2025-05-02

119 Items: cancapcarcatCEOcakecallcampcardcarecasecashcastcellchefchipcitecityclubcluecabincablecarrycatchcausechainchairchartchasecheapcheckcheekchestchiefchildcivilclaimclasscleanclearclimbclockclosecloudcameracampuscancercarboncareercenterchancechangechargecheesechoicechoosechurchcircleclientclinicclosercabinetcapablecapitalcaptaincapturecarefulcarrier...

Sip and Search 2025-07-09

20 Items: City Noah was bornNoah's middle nameJordan's horses nameWhat colour is BadgerColour of Jordan's carJordan's astrology signJordan's favourite ciderJordan's favourite flowerNoah's favourite activityNoah's favourite videogameWho lives with Noah & JordanWhere did Noah & Jordan meetWhere Noah proposed to JordanJordan's favourite warm drink...

RTC Employee Word Search 2026-03-06

14 Items: Ashlie's dogMichelle K. catScott M's classic carTrisha's newfound hobbyJennie's favorite flowerAustin does this as a hobbyThis employee has six sistersScott G drives this color vehicle.Nicole C. is training for this eventRides his bike to work rain or shineJeremy is due to have his ________ child.This manager has wooden toys in their office....

hannah’s faves! 2025-11-04

9 Items: a car driven by two brothersthey’re not zombies, they’re …an animal with a long appendagethe middle name of the winter soldierthe first track on horan’s third albumwhat lindsay lohan plays in parent trapa slash ship from a show set in los angelesthe main character in a book you might’ve read in school...

Transport 2026-02-18

20 Items: A beautiful, expensive boat.A large animal that people can sit on to travel.A vehicle with two wheels and a powerful engine.A small bus that usually has about 8 to 15 seats.A large, strong vehicle used for carrying heavy things.A comfortable bus used for long journeys between cities.A very large boat used for traveling across deep oceans....

Bach 2023-04-25

93 Items: bwvcarcatdogowlpigsuntopbachballbearduckfarmfishharphornjokelamplionpetsponybirdsbunnychaseclockclownflutefuguehorselaughmarchmousemusicorganpianorikkirobotscarytruckafraidchordscreepydragonfarmerflowerjokingminuetmonkeymurrayrabbitrhythmrobotsscaredspookyanimalsballoonbaroquechasingchickenkineticmusicaloctopusroostertoccataballoonschickensdinosaur...

Michael Word Search 2025-01-29

22 Items: His dream carRob's occupationHis favorite songRob's middle name?City Rob was born in?Rob's nickname for JudyNickname he calls Haley?High School Rob attendedRob's mother's first nameColor of Rob's VolkswagenFavorite food on the grillFavorite relaxing past-timeThe number of tattoos he hasFavorite food that Mike cooksRob's favorite form of exercise...

How well do you know me? 2025-03-28

23 Items: My last name?My eye color?Dogs or cats?Marvel or DC?My first name?My middle name?My sisters name?My schools name?My favorite color?My favorite season?My favorite animal?My 1st brothers name?My 2nd brothers name?Month of my birthday?Sport I used to play?The day of my birthday?What number car am I on?Where was our first date?...

Simple Present Word Search! 2025-04-19

20 Items: My aunt ______ to work.It ______ a lot in April.His mom ______ dinner at 6.I ______ breakfast at 7 a.m.Her cat ______ on the couch.The dog ______ at strangers.We ______ movies on weekends.Your sister ______ very well.You ______ to school every day.Tom ______ math in the evening.They ______ soccer after school.The teacher ______ on the board....

7th Energy Word Search 2025-11-18

21 Items: Stored energyBall on a hillEnergy in motionFossil fuels, foodEnergy through heatSpring or rubber bandCurrents in a circuitStored in the nucleusCar moving, skateboardPart that is being studiedMovement of thermal energyHeat transfer through fluidsEverything outside the systemHeat transfer through direct contactLight, electromagnetic waves from sun...

Travel (Medium) 2026-01-17

25 Items: Jet lag causeBag for travelViewpoint spotBag worn on backVisit to exhibitsChain of mountainsGetting directionsTicket for a flightPlace trains arriveRegional food styleBoat ride at sunsetLong walk in naturePlace flights departGuided route on footFalling river featureProtected nature areaPlace to buy memoriesReservation for a stay...

Open House Word Search 2025-07-01

16 Items: Where do you play?Where do you sleep?What has eight sides?Where do you eat meals?What is made from trees?Where meals are prepared?Where do you park your car?What is soft but stepped on?What's the Agent's last name?Where do you store your food?Where is the best place to be?What's the Agent's first name?What holds your plates and cups?...

Prepare 4 2025-10-12

11 Items: vey bigvery badvery tiredvery smallcalm and not busydifficult to think it's trueto go away from someone or somethinga young person between 13 and 19 years oldto leave your job or stop working because of old age or ill healtha written message from one person to another, usually put in an envelope and sent by post...

Roller coaster 2025-04-17

11 Items: gravityany push or pullgravitationconstanthow fast something movesa force that draws to eachotherThe energy of an object in motionThe force exerted on an object by the Earth'sThe energy stored by an object ready to be usedA force caused by a rubbing motion between two objects.A combination of speed and the direction in which an object travels...