car brands Word Searches

Spanish recap 2023-07-20

30 Items: a cara busa beda farma towna citya housea coacha tablethe poola windowI live ina cottagethe beachthe atticby the seathe churchthe cinemato sunbathethe kitchenan aeroplanethe water parkthe theme parkto the left ofthe post officeto the right ofthe living roomthe dining roomto swim in the seathe shopping centre

Review Words Level 1 2024-07-19

103 Items: axoxupantbedcatcupcardogeggfanhatdoginkjetjamkeynutnetpensunvanvetwebfoxboxsixwaxyakzoobearbirddeskdollduckfishfarmforkgoatgiftgirlkingkitelionlampleafmilknestnosequizrosericesealsoaptentvestwolfzeroappleelbowhorsehouseigloojuicelemonmouseolivepeachpandaqueenquiltrobotsockstigerunclewaterwatchyo-yoyachtzebrabananainsectiguanajacketmonkeyrabbit...

Bank Accounts and Terminology 2025-06-21

21 Items: VISA$19 feeLoan for a CarRetirement planLoan for a HouseNo minimum balanceCredit for a HouseType of InvestmentSignature Guarantee$5 to keep account openMinimum balance of $2500Educational Savings PlanTotal Amount of InterestType of Overdraft ProtectionAnnual Cost of Borrowing MoneyMonetary Instrument with $3 feeMonetary Instrument with $5 fee...

Our own 2026-03-29

35 Items: readreadplayselfdrivecatchtrackspeedsnailstudystrongnova isdance taplast nameI love youvideo gamelift heavyour schoolDaddy's sonhappy danceflip on barwe are happyplace to learnto talk to godlove seeing itDaddy's daughterGia and nova dadDaddy's computerwhat's your nameJackson musicianPettit & Stadokasomething to watchour favorite color...

Christmas Word Search 2022-12-22

17 Items: frozen rainSanta's carChristmas Grandpathe sound of bellssomething for a fireanother word for giftan old word for happywhat we do to the treeput the gifts under thiswhat month is Christmas?another place to put giftskids want these from Santaa treat we leave for santathey carry Santa in the skythey help Santa make the gifts...

Safety Week Word Search 2026-04-09

17 Items: G______ WalkPPE for your eyesPPE for your feetPPE for your bodyLock Out T___ OutFire E__________.PPE for your earsPPE for your handsPed Seg keeps who safer?It might be something dangerousWork Safely to Prevent an I_____.Probably weighs more than your carCall N______ Triage in an emergencyUse to clean out your eyes in emergency...

car 2024-03-20

1 Item: ferrari

Site words 1 2023-01-13

113 Items: hegoinismetoitmyweonatasofifambedonousuporcanyouseegetnotanddidrunforwasareallbigboybutcardayeatfunhadhasherhimhishownewnowoffoldoutransawshewhywhooneusetwoanysaidhavelikeawaybestcomedownfromgirlgivegoodherelookmademakeoverplaysometellthatthemtheythisthemwantwhenwhatwentwillwithyourweregirleachbeenwordmanyintodoesafteraboutcan’thousetherethingwould...

CHAPTER 8 2025-04-29

103 Items: ADDONLYTIMEONLYALSOWHENPLACETHERELIMITMEANSREALLYDEGREEREALLYMANNERBY-CARPROVIDEPROCESSFRANKLYHOWLONGSTANDINADJUNCTSNEGATIONFOCUSINGLIMITERSSLIGHTLYLOCATIONHOWOFTENPROFORMSVIEWPOINTYESTERDAYDISJUNCTSCONJUNCTSTHEREFOREAFTERVERBADDITIVESINTENSITYCAREFULLYDIRECTIONEMPHASIZEADVERBIALSAFFECTEDBYPERIPHERALAMPLIFIERSCOMPLETELYDOWNTONERSINSTRUMENT...

Taylor Swift Songs (2 Words) 2026-03-02

56 Items: ________ ItBad ________________ Man________ Bow________ BadEnd ________________ God________ One________ CarHey ________________ BoyMad ________New ________________ NewOur ________________ Fly________ NowTim ________Dear ________Dear ________________ Open________ RushHigh ________Hits ________Holy ________Last ________________ HazeLong ________...

The Circuit 2025-11-13

11 Items: to getperiod of timeto discover or noticethings owned by someonefarm where grapes are grownbuilding where a car is keptthe leader of a group of workersin a slow or nervous way, not sureto enjoy something for a long timea path already set and goes from one place to the nextto place items in bags, suitcases, or boxes to move them

trs23 ie2 u3p2 2022-11-16

10 Items: Doesn't work.It has 2 wheels.It can fly. It has wings.It's big and has 4 wheels.It can fly. It doesn't have wings.It's very big and has 4 wheels. (Br)It's very big and has 4 wheels. (US)You can see it on a yo-yo and a kite.It is round. It is on a car and a bus.Two overlapping circles with things inside.

Iloveyou Word Search 2026-02-03

10 Items: our first kissour fav icecreamwhere we first metfirst board game together"you only **** 1/3 of me??"these are growing in your backyard!i <3 early morning breakfast with you herea ray rays best friend (hint: "a mans best friend")model of car i accidentally hit in the garage freshman year...

English III 2026-04-06

10 Items: Camels live in the _________Have you ever _____ in a plane?I booked our tickets 2 days _____A bike is __________ a car (cheap)I need to know how to use a ________The garden is a mess, can you _________?He works in an office, he is a ___________why don't you ______ this local dish? (verb)I like cold weather, that's why I like ______...

My first 50 words 2023-02-14

50 Items: unoaguataximesarojovidacasaniñacafégatoniñoazulcamamujerfaldaaviónplumahotelamigoperrorelojsillacochenegrobolsoángelinglésblancoshortsdinerohombrecomidabailarciudadlibroszapatosnaranjavestidobotellamanzanaamarilloparaguasnoticiaschamarraenfermeraluz/ligerohamburgesacocinero/chefcompañeros de clasepantalón de mezclilla

Do Word Search 2023-05-17

28 Items: hooverget upget homego to bedwatch DVDsplay chesshave lunchgo shoppingget dressedhave dinnerdo homeworkwash the cartidy my roomsurf the Netgo to schoolhave a showerdo the washingread magazineshave breakfastlisten to musicbrush my teethgo to the cinemaclean the windowsdo the washing-uptalk on the phonetake out the rubbishhang out with friends...

CHAPTER 8 2025-04-29

103 Items: ADDONLYTIMEONLYALSOWHENPLACETHERELIMITMEANSREALLYDEGREEREALLYMANNERBY-CARPROVIDEPROCESSFRANKLYHOWLONGSTANDINADJUNCTSNEGATIONFOCUSINGLIMITERSSLIGHTLYLOCATIONHOWOFTENPROFORMSVIEWPOINTYESTERDAYDISJUNCTSCONJUNCTSTHEREFOREAFTERVERBADDITIVESINTENSITYCAREFULLYDIRECTIONEMPHASIZEADVERBIALSAFFECTEDBYPERIPHERALAMPLIFIERSCOMPLETELYDOWNTONERSINSTRUMENT...

DII - Komm mit! K2-2 2025-12-04

23 Items: choresto dustat hometo cleanto vacuum(to) hometo go shoppingto mow the lawnto make the bedto set the tableto watch a movieto polish the carto wash the dishesto clear the tableto dry the clothesto wash the clothesto iron the clothesto go to the moviesto go into the cityto water the flowersto take out the trashto help in the kitchen...

Police Call Type 2023-11-28

20 Items: Someone broke into my barn.Someone broke into my house.There is a snake in my living room.There are dogs loose in my neighborhoodMy 14yo did not come home from the movies.I need to report an alarm from a business.My ex said he was going to come beat me up.There is a large piece of metal in the road.My 24yo daughter did not come home last night....

trs23 ie3 u6 p1 2023-01-31

12 Items: A small city.A place to swim.A place to watch movies.A place to walk and run.A place to buy fresh food.A place to leave your car.A place to learn and study.A place to sit down and eat.A place to send a letter or box.A place to read and borrow books.A place to travel to another city.A place to buy lots of different things.

trs23 ver3 u13 2023-05-31

10 Items: Lions can run ___.Look ___ the window.A shape with no corners.Something not from Earth.A car has 4. A bike has 2.Cars, trains, buses, planes etc.A kind of small animal with a long tail.It is white or grey and it is made by fire.It has wheels but it doesn't drive on the road.How you feel if someone says "Boo!" behind you.

Brand Search 2025-07-23

19 Items: Which brand says “Have It Your Way”?Which brand’s logo features a swoosh?What brand uses a bitten apple as its logo?What brand uses an arrow from A to Z in its logo?What brand was represented by a light blue bird logo?Which brand uses the slogan “Because You're Worth It”?Which coffee chain has a twin-tailed mermaid as its logo?...

Memory Word Search 2025-09-13

19 Items: A TV ShowA Dairy CowA Gem StoneA Rail SidingA Month in Springwhat trains run onBirthday Boys NameSinger of True BlueYamaha AG100 is whatTransport Gangers DroveSinger of Pub with no beerModel of car made by HoldenWhat number birthday is thisWinner of State Of Origin 2025Nail used to hold down rail lineHow many stars on Australia flag...

car 2024-10-04

1 Item: car

Car 2026-02-05

1 Item: car

Jag, Word Search 2023-04-08

1 Item: jaguar, car, loud, fast, car, dad, jag, jaguar, loud, fast, car, dad, jag, car, loud, fast, dad, jaguar

Secret Santa 2025-11-23

9 Items: Who has ridden an ostrich?Who tried to free a captive?Who is the richest according to Bailey?Who proposed after a splits competition?Whose first car was as old as they were?Who's name have you drawn for Christmas?Who made the most memorable green bean casserole?Who can't hum a song if they don't know the lyrics?...

The car word search 2025-10-11

2 Items: f1anticonstituellement

Local Word Search 2026-01-04

15 Items: a ball of airmore than twoto ride a bikemade from plantsallowed by the lawnear where you livea desert animal with a humpto risk money to try to wina container used to boil watera long passage under the groundto go from one place to anothera woodland animal that eats nutsawake at night, asleep in the dayyou travel in it like a car or bus...

Prefix SUPER 2026-03-23

10 Items: Someone who is very strongEyes that can see very farA car that goes incredibly fastA loud sound that shakes the roomA power that is amazing and magicalA jump that goes really, really highA mood when you feel extremely happyA place where you buy food and snacksThis person saves the world and wears a cape...

Ruber Word Search 2024-06-06

10 Items: U need to ask the teacher a...She is...a letter to her friendSomething to erase your mistakesYou write with...on a whiteboardYou glue things together with...In class we have to...our teachersI just broke my car. Can you repairMy father has a passion for footballyou write on a...with chalk in the class...

Our story 2026-02-02

10 Items: Our favorite activityMy first gift from youOur first trip overseasThe month we made it officialThe day I knew that I loved youThe bar we had our first date atThe place we met for the first timeThe trip we when on after breaking upThe name of the boy that I love so deeplyOur current favorite song to jam to in the car

Past/Present Tense 2025-05-07

12 Items: I wish I _____ my cookie.The car has been ______ up.I watched my Dad as he ______.I ________ all of my homework.I got a new dress which I _____.Yesterday I went home and ______.We ______ to the Ice Cream Store.I ______ my grandmother make cookies.I have ______ to him about the problem.She _____ if I could come to her house to play....

Easter 2023-04-08

1 Item: jag, car, blue, white, car, jaguar, jag, loud, fast, dad, jag, jaguar, car, loud, blue, white, fast, car, loud, dad

AUTO 2025-11-14

10 Items: stop your carto pressurize refrigerantfan to circulate the cooled airto remove moisture and impuritiesto cool and liquefy the refrigerantto absorb heat and cool the cabin airvalve (or orifice tube) to regulate pressureare the suspension parts that connect the control armsare small rubber or polyurethane components that provide cushioning...

uwu 2019-06-11

115 Items: aIasatbebydogoheifinitactaddageagoairallandanyarmartaskbadbagbarbedbigbitboxboybuycancarcupcutdaydiedogeatfarforgasgetherjobablealsoareaawaybabybackballbankbasebeatbestborncallcardcareeasyedgegoalheadhelpaboutaboveadmitadultafteragainagentagreeaheadallowalonealongamongapplyargueavoidacceptacrossactionaffectagencyalmostalwaysamountanimalansweranyone...

Branding 2023-12-29

14 Items: a car horse?computer makera green mermaid2 all beef pattieswhere astronauts train?no trains, but sandwichesused to be called Facebooka fruit that makes a phone?bulls eye with no merchandiseit’s a company, not a verb to make copiesa ruined social media app now called ‘X’ (lol)a soft drink that may or may not have contained cocaine...

Around Town 2026-01-12

10 Items: A tall buildingA place you can borrow booksA place you can park your carA place people store their moneyThe place you go to take the busSomething you use to find your way aroundA place where you can ride a rollercoasterA large square with many different sellersA place you go to practice different sports...

Jen Trivia: Word Search Edition 2023-07-10

25 Items: Jen's majorHer last nameHer first nameHer middle nameA sport Jen playedA sport Jen playedJen's Favorite foodJen's Favorite colorJen's Favorite animalThe name of Jen's carOne of Jen's DIY PhasesOne of Jen's DIY PhasesOne of Jen's DIY PhasesJen's favorite video gameJen's favorite soft drinkJen's favorite/lucky numberThe high school Jen attended...

TS 1 2025-09-20

80 Items: BUGREDNOWEGGCARFLYWOODHAZEGAMELIVESONGGREYSWIFTHONEYLOVERPOETSKARMASPACEBETTYRINGSBLOODSTYLEAGAINSTORYHORSEWOMANTAYLORTAYLORFIGURELUXURYLIGHTSORANGESTREETSTRINGSUMMERWILLOWMAROONMCGRAWGUITARAUGUSTBENSONBUTTONOPHELIAOPALITESPARKLESHOWBIZMASTERSSHOWGIRLDAUGHTERROMANTICWISHLISTILLUSIONFOLKLOREEVERMOREFEARLESSTHIRTEENBLACKDOGTOO WELLCARDIGANMARJORIE...

Jenna & Spencer OO 2024-10-14

25 Items: grooms siblingbrides siblingbest mans namegrooms car colorbrides middle namegrooms middle namegrade Jenna teachesmonth groom proposedcolor of grooms eyesgrooms birthday monthbrides college mascotbrides favorite colormatron of honors nameschool Jenna teaches atcity the couple lives inmother of the grooms namemother of the brides name...

Ali Word search 2025-03-22

115 Items: hecatdogAliCarsowairgasloglionAsmaTacolookclueformdealkinglendmythholemegabellcaveloopfinearchrankblowpawnpasszebrahippoAabanAayanRabiaBismaPlaneshakevalueyoungsmallstingstandslumpstudymeritleashstateagenttempthousetitleaspecteffluxdealeranimaladmiresecurepastelexceedregretextendbuttonassumeappliedhaircutstudentpyramidconfuseimpoundapprovehostile...

Most Common Words That Start With C Part 1 2025-05-02

119 Items: cancapcarcatCEOcakecallcampcardcarecasecashcastcellchefchipcitecityclubcluecabincablecarrycatchcausechainchairchartchasecheapcheckcheekchestchiefchildcivilclaimclasscleanclearclimbclockclosecloudcameracampuscancercarboncareercenterchancechangechargecheesechoicechoosechurchcircleclientclinicclosercabinetcapablecapitalcaptaincapturecarefulcarrier...

Sip and Search 2025-07-09

20 Items: City Noah was bornNoah's middle nameJordan's horses nameWhat colour is BadgerColour of Jordan's carJordan's astrology signJordan's favourite ciderJordan's favourite flowerNoah's favourite activityNoah's favourite videogameWho lives with Noah & JordanWhere did Noah & Jordan meetWhere Noah proposed to JordanJordan's favourite warm drink...

RTC Employee Word Search 2026-03-06

14 Items: Ashlie's dogMichelle K. catScott M's classic carTrisha's newfound hobbyJennie's favorite flowerAustin does this as a hobbyThis employee has six sistersScott G drives this color vehicle.Nicole C. is training for this eventRides his bike to work rain or shineJeremy is due to have his ________ child.This manager has wooden toys in their office....

hannah’s faves! 2025-11-04

9 Items: a car driven by two brothersthey’re not zombies, they’re …an animal with a long appendagethe middle name of the winter soldierthe first track on horan’s third albumwhat lindsay lohan plays in parent trapa slash ship from a show set in los angelesthe main character in a book you might’ve read in school...

Transport 2026-02-18

20 Items: A beautiful, expensive boat.A large animal that people can sit on to travel.A vehicle with two wheels and a powerful engine.A small bus that usually has about 8 to 15 seats.A large, strong vehicle used for carrying heavy things.A comfortable bus used for long journeys between cities.A very large boat used for traveling across deep oceans....

Bach 2023-04-25

93 Items: bwvcarcatdogowlpigsuntopbachballbearduckfarmfishharphornjokelamplionpetsponybirdsbunnychaseclockclownflutefuguehorselaughmarchmousemusicorganpianorikkirobotscarytruckafraidchordscreepydragonfarmerflowerjokingminuetmonkeymurrayrabbitrhythmrobotsscaredspookyanimalsballoonbaroquechasingchickenkineticmusicaloctopusroostertoccataballoonschickensdinosaur...

Michael Word Search 2025-01-29

22 Items: His dream carRob's occupationHis favorite songRob's middle name?City Rob was born in?Rob's nickname for JudyNickname he calls Haley?High School Rob attendedRob's mother's first nameColor of Rob's VolkswagenFavorite food on the grillFavorite relaxing past-timeThe number of tattoos he hasFavorite food that Mike cooksRob's favorite form of exercise...

How well do you know me? 2025-03-28

23 Items: My last name?My eye color?Dogs or cats?Marvel or DC?My first name?My middle name?My sisters name?My schools name?My favorite color?My favorite season?My favorite animal?My 1st brothers name?My 2nd brothers name?Month of my birthday?Sport I used to play?The day of my birthday?What number car am I on?Where was our first date?...

Simple Present Word Search! 2025-04-19

20 Items: My aunt ______ to work.It ______ a lot in April.His mom ______ dinner at 6.I ______ breakfast at 7 a.m.Her cat ______ on the couch.The dog ______ at strangers.We ______ movies on weekends.Your sister ______ very well.You ______ to school every day.Tom ______ math in the evening.They ______ soccer after school.The teacher ______ on the board....

7th Energy Word Search 2025-11-18

21 Items: Stored energyBall on a hillEnergy in motionFossil fuels, foodEnergy through heatSpring or rubber bandCurrents in a circuitStored in the nucleusCar moving, skateboardPart that is being studiedMovement of thermal energyHeat transfer through fluidsEverything outside the systemHeat transfer through direct contactLight, electromagnetic waves from sun...

Travel (Medium) 2026-01-17

25 Items: Jet lag causeBag for travelViewpoint spotBag worn on backVisit to exhibitsChain of mountainsGetting directionsTicket for a flightPlace trains arriveRegional food styleBoat ride at sunsetLong walk in naturePlace flights departGuided route on footFalling river featureProtected nature areaPlace to buy memoriesReservation for a stay...

Open House Word Search 2025-07-01

16 Items: Where do you play?Where do you sleep?What has eight sides?Where do you eat meals?What is made from trees?Where meals are prepared?Where do you park your car?What is soft but stepped on?What's the Agent's last name?Where do you store your food?Where is the best place to be?What's the Agent's first name?What holds your plates and cups?...

Prepare 4 2025-10-12

11 Items: vey bigvery badvery tiredvery smallcalm and not busydifficult to think it's trueto go away from someone or somethinga young person between 13 and 19 years oldto leave your job or stop working because of old age or ill healtha written message from one person to another, usually put in an envelope and sent by post...

Roller coaster 2025-04-17

11 Items: gravityany push or pullgravitationconstanthow fast something movesa force that draws to eachotherThe energy of an object in motionThe force exerted on an object by the Earth'sThe energy stored by an object ready to be usedA force caused by a rubbing motion between two objects.A combination of speed and the direction in which an object travels...

Girlfriend Trivia 2025-12-22

10 Items: my dog that loves youwhat month is my birthdaygolf our first date activitywhat color was my hoco dresswhat did I dress as for halloweenare you going to let me drive your car;)what we resisted doing at the Elf Musicalwhat color are my eyes... its also our fav colorthe restaurant I introduced you to that you now love...

Vocab- H 2025-08-22

10 Items: It gives light when it’s dark.You put books or objects on it.A place where you park your car.You walk on this inside a house.A table where you study or work.You look at your reflection in this.A soft floor covering made of fabric.A big chair where many people can sit.You walk up or down on these to change floors....

IRREGULAR VERBS, CAR/GAR/ZAR, BYE BYE I HELLO Y 2020-09-17

5 Items: irserdarverbuscar

Car Word Search 2025-01-16

1 Item: CAR

Transportes 2025-10-02

1 Item: CAR

Car Word Search 2025-08-15

1 Item: Car

STUFF 2023-04-03

9 Items: your paycheckI want my payI bought a carI have so little moneyI got 1 gummy and you got 1 gummyCanada just sent us a lot of syrupI got this for 2 dollars here when it was 5 at WalmartI bought this for 10 dollars but I got 20 dollars for itand demand I only have 10 of this but 20 people want it

Spelling 4 2024-03-27

10 Items: accurate, not falseto press against with forcepart of the body on the handa raised platform in a theatercreate a picture using a writing utensilanother word for car; short for automaticgive or hand over something in exchange for moneyhaving or showing a high degree of mental abilitya hint or piece of evidence that helps with the answer...

Ens 2023-03-06

1 Item: car

Car Word Search 2026-03-17

1 Item: car

Words You Know 2026-03-13

15 Items: You do this sportYou like this foodYou go here to studyYou use this to drinkYou can go places in thisYou did this at PancasonaThis is your sister's nameYou eat this in the morningThis is someone you play withYou get this on your birthdayThis animal is black and whiteThis is the country you come fromYou put your head on this at night...

Words You Know 2026-03-13

15 Items: You do this sportYou like this foodYou go here to studyYou use this to drinkYou can go places in thisYou did this at PancasonaThis is your sister's nameYou eat this in the morningThis is someone you play withYou get this on your birthdayThis animal is black and whiteThis is the country you come fromYou put your head on this at night...

Transp 2025-10-02

1 Item: Car

Into the Wild Ch 4-6 Review 2024-11-05

15 Items: Made this with Ron ________Ron offers to... _________ ________Abandoned his car here __________ _______Where Chris worked in Arizona ____________Where Chris met Ron ___________ ___________Chris hated this item of clothing _________Chris described him as a lunatic __________Where Chris went on his canoe trip __________...

Health and hospital 2023-02-13

25 Items: fleecedrug dosagesick at earsick at eyesick at backsick at headsick at teethsick at mouthto see bacteriasick at stomachto treat diseaseto lift the sickto wipe the woundto cover the woundto check the heartbeatto help disabled peoplea people who help doctora car to carry sick peopleplace to care for the sickto measure body temperature...

Ant Word Search 2025-02-19

129 Items: ANTARMBOYBOXCAPCARCANDOGEYEEAREGGFANFOXINKJETJETJAMLEGMANNUTREDRUNSUNTOEYAKBALLBIRDBODYBOOKBLUECAKEDESKDOLLFACEFOOTFIVEGAMEGIRLHANDJUMPROPEKITEKNEELAMBLEFTLIONMOONNOSENESTNINEOUCHOVALPINKSTARSWIMVESTWALKYARNYOYOZEROAPPLEBLACKBROWNCANDYCOLORDANCEELBOWGREENHEARTHOUSEHORSEIGLOOINSETJUICEJUICELEMONMOUTHPEACHQUEENQUILTRIGHTRIGHTRADIOTABLETOUCHUNCLEWATCH...

hard workscreach 2025-08-02

118 Items: UpHenAirCatDogBigSunMadSadLegArmCarMomDadgasHomeEggsPlusThinLongMoonCoolCuteOpenDownLeftNeckHeadHairNoseBoneOvalCubeStarCalmBikecarsSandWoodcityClayBackcycleMinusWaterSleepLarvaKittyPuppySharpShortSmallEarthPlutoAngryBirdsCloseRightHeartBrainHeartHappyGreenTreesTrainPaperGlassMetalSharpRocksAdultFrontFamilyCocoonSaturnMecuryCreepyShapesCircleRubber...

PRVI SVJETSKI RAT 2023-02-26

31 Items: država stvorena 1913.lav sa Soče, Svetozarbroj balkanskih ratovaprovela je A- U nad BiHfrancuski general, Josephmjesto najveće pomorske bitkeatentator na Franju Ferdinandazemlja koja je ušla u rat 1917.ruski car koji je abdicirao 1917.vijeća radnika, seljaka i vojnikanaziv za Balkan na početku 20. st.mjesto atentata na Franju Ferdinanda...

Spanish 37 2023-04-17

33 Items: roomgarageto livekitchento helpto cookto givefar frombathroombasementapartmentdiningroomhome officethird floorliving roomstory, floorground floorsecond floorclose to nearto cut the lawnto feed the dogto make the bedto wash the carstairs, stairwayto set the tableto wash the dishesto wash the clothesel polvo to dustto clean the bathroom...

mixed 2025-05-01

122 Items: buscardogcatpigyatewizztaxilegogoatlambrungrangtrainguardfaultleedsplanegreenblackwhitemathsblankqueenbleekplacemusicpianocelloviolabrasssignaldundeeticketenginedieselyellowspookyburialguitarrailwaystationjourneydelayedjubileetauntonsaltasheasyjetenglishsciencephysicsbiologybeetleshamstertrumpetstringsbakerloovictorianorthernpenzanceplyomuth...

Hannah & Allen 2025-08-21

27 Items: Allen’s hometownAllen’s first carAllen’s first nameCouples dog’s nameCouples cat’s nameHannah’s universityMonth Allen proposedGrade the couple metLast name they shareHannah’s maiden nameCouples favorite beerHoneymoon destinationLocation of engagementCouples favorite liquorName of elopement venueHannah’s favorite seasonCouple’s favorite TV show...

Cerca Parole 2025-10-20

60 Items: mumdaddogcatbigcartalltramnicekindlazycitytourtripshipunclehappyhappybeachtrainsmallItalyChinaferryfiftyfamilysisterauntiesportystrongcruiseFranceelevengrandmagrandadbrotherseventycampingautobusholidaycheeckybicyclehundredthirteennineteencreativemountainairplanebeautifulice creamAustraliamotorbikecousin (m)cousin (f)forty fiveintelligentcountryside...

INGLISE KEEL 2026-01-26

60 Items: teeuksõunisaõdeükskasskoermururottautorongmajakolmnimilindviiskõrvhiirkarppilvkalanõidemmemustsebrapäikekübaraastapoissvalgejuustEestisininelennukämblikhobuneraamattüdruklammasüheksaelevantkollanekaheksavanaemaüksteistjalgpallkuningasmesilanekorvpallrohelineloomaaedperekondkaksteistjalgrataskuusteistsülearvutikakskümmendpurpurpunanetindipliiats

i love you <3 2023-06-30

10 Items: Our song :)My first ever gift to youYour first ever gift to meYour first nickname for meThe month of our anniversaryMy favorite nickname you have for meThe place where we first had umm car timeThe animal that I painted for you at As You WishThe color of the flower you gave me for my 18th birthday...

trs 3b w17 pt2 w18 2022-06-15

10 Items: adj. Not strong.adj. Not smart. Silly.n. The boss of a group.v. Come back or go back.n. A kind of fish. Not a horse!v. Run after and try to catch something.n. A mammal that looks a bit like a sheepn. A place that you go to fill up your car.n. It goes over a river so people can cross.n. A place to put things inside. Where a baby kangaroo lives.

Daniels and Welch OO 2024-10-06

45 Items: We are the sameGroom’s siblingBride’s siblingCouple’s cat nameCouple’s dog nameOysters or Caviar?Bride’s middle nameJessica’s dream carBest man’s nicknameSAW’s favorite foodStephen’s first jobJessica’s first jobJessica’s eye colorIt was love at firstStephen is a _____ ___Groom’s childhood cityType of party we met atStephen’s favorite beer...

Spanish 37 2023-04-17

33 Items: roomgarageto livekitchento helpto cookto givefar frombathroombasementapartmentdiningroomhome officethird floorliving roomstory, floorground floorsecond floorclose to nearto cut the lawnto feed the dogto make the bedto wash the carstairs, stairwayto set the tableto wash the dishesto wash the clothesto clean the bathroomto put,to place,to set...

trs22 5b w13 pt1 2022-07-04

12 Items: n.Riding an animal.n.Skating on wheels.n.Driving a small car around a track.n.Going forwards down a snowy mountain.n.Going sideways down a snowy mountain.n.Walking though forests and mountains.n.Riding a bike across rough, natural paths.n.Moving across the ice using special shoes.n.Standing on a board and getting blown by the wind....

Cool Jobs 2024-07-14

50 Items: sospyvetsaidchefactormodelbakeragentnurseartistdancerfarmersingerwriterwanteddoctorboringathletedentistteachergood atbecausejanitordesignermagicianmusiciansalesmanexcitingastronautlibrarianpresidentscientistjournalistsaleswomanbusinessmaninterestingi want to befire fighterbusinesswomanin the futureinterested inparty plannerwhen i grow up...

ELA Fall 2025 2025-12-16

115 Items: EdCarAnhIanGloBreMeadSeleVaneAddyJoseCiciKyleEllaOmarKhyeCaroJoseMisaHerotHazelFelixLopezMariaJasonTylerUrielAnahiRolisJaxenAnhelAidenMangoVickyRyleeNaomiKyleyLydiaRomanNadiaLamarDavidMotherDragonWiglafGeorgeJordanWaltonAgathaArissaCarlosHectorCarsonKalaniDakotaLazaroRilynnBrissaJoshuaMorganAudreyNicoleHaydenThomasNicoleAlexusBrysonEKingsJaiden...

Family word 2026-02-14

16 Items: who's is Lunas' mom?what month is new years?what color is dad's car?who likes monster trucks?who is the oldest sibling?what's another word for dad?what month is Max's birthday?how many months are in a year?what was Avery's pet fish name?what month does halloween fall on?what month is Amber's birthday on?how many people are in this family?...

Verbs with -ING 2025-11-12

18 Items: Jason is ............. a book.Jaime is ........... to David.Jonas is ................ his car.The teacher is ........... a story.Mrs Smith is ........... her tablet.My friends are ............. a film.I'm ................... to music now.Mike is .............. on his notebook.I'm ............ a photo of my friends....

Mystery in the Cereal Bowl 2025-10-24

11 Items: Worked with Wallace at Taco BellHenry Louis Wallace's last victimHenry Louis Wallace's first victimOnly victim Wallace murdered using a rockPalm print was found on this victim's carVictim was killed and found in her own homeVictim was murdered in front of her two sonsHenry Louis Wallace's youngest victim (18 yrs old)...

27 2025-08-17

15 Items: Lesser crime.Taken into custody.Short-term detentionFound guilty in court.Long-term jail facility.Punishment ordered by court.Organized set of riders traveling togetherEmblem showing affiliation with a motorcycle clubMetal container for fuel or oil carried on long ridesMeeting place for a specific branch of a motorcycle club...

Word Search 2023-05-30

130 Items: yeszipzapmaxwaxmixanyallfewtheyouarecanhadandbutyetnotcardograttwofanhanvanbanmanpanrantanjetslyartviewmainborntimewaitgoodclublefthurtcorncitycookswanbeanspanplanloanmeanmoanstopealbumallowalarmbriefthiefchiefcheckchuckenjoyshinyissuedrawnfrontcatchfetchclunkotheraboutwhichtheireverylunchfaithclothclownowletscowlpianoflamerighttowelbegantopazhuman...

vocab 2026-02-12

37 Items: roommoneygarageto livekitchento helpto cookto givefar frombathroombasement-a clean-a dirtyapartmentto receivedining roomhome officeliving roomthird floorif, whetherstory, floorsecond floorground floorWhich (ones)?close to, nearto feed the dogto make the bedto wash the carstairs, stairwayto set the tableto wash the clothesto clean the bathroom...

Riley and Kamran OO 2024-05-31

29 Items: Kam's eye colorFirst movie dateMake of Kam's carCouples dog's nameKam's sister's nameRiley's middle nameBest man at weddingCouple's cat's nameKam's birthday monthMonth they first metRiley's mother's nameRiley's sibling's nameRiley's nursing schoolKam's youngest brotherRiley's birthday monthRiley's favorite sportKam's favorite cuisine...

Summer of the Mariposas 2023-03-16

17 Items: Spanish for mermaidNarrator of the storySpanish for butterflyDelia and Velia are _____Youngest of the Garza sistersColor of the dead man's houseUS state where the Garzas live"Too much cream spoils the ____"Model of Papa's car the girls tookLast name of the author of the bookEnchanting hostess who served treatsLa Llarona's role in the Hero's Journey...

EC2 UNIT #3: ¿Te acuerdas? 2025-01-05

44 Items: carcarcityeastnearwestparktrainnorthundersouthstoreplacesavenuemarketmuseumbakerysquarestreetto buyto walklibraryto takebuildingfar fromgeographyto explorecoffee shopin front ofsupermarketbutcher shopmovie theaterto go by footto the left ofto go by metroto the right ofto drink coffeeto ride a bicycleto eat/have lunchto eat/have dinner...

2 & 3 Letter Words 2026-04-15

129 Items: amanasatbebydogoheifinisitmemynoofonorsotoupusweandantanyarearmartaskbadbagbanbatbedbeebegbetbigbitbusbutbuycancapcarcatcowcrycupdaydiddigdogdryeateggendeyefarfewfitflyforfungetgotgumhadhasherhimhishithothowinkjoykeyletliploglotlowmadmapmatmaymixmetnewnotnowoffoldoneoutownpenpetpinputranredrowrunsadsatsayseaseesetshesitsonsunteatenthetootrytwouse...

MG trivia word find 2026-03-21

14 Items: MG’s famous driving mottoThe MGB’s removable roof styleTwin carb brand used on many MGsPopular MG model built 1962–1980MG factory town for over 50 yearsMG’s famous club social traditionClassic MG colour, deep and iconicMG’s 1990s mid-engine revival modelMG’s 1950s saloon with Italian stylingMG’s 1950s–60s two seat classic with curves...