brain Word Searches

Ch. 16 Medical Terminology 2024-02-16

5 Items: fear of heightsfluid in the brainuncontrollable sleep attacksfear of enclosed or narrow spacesdrug that prevents pain by causing a loss of feeling

Piaget stages 2024-04-16

10 Items: groupingsecond stagethe first stageyou are in this stagethe study of the brainfully understanding ideasChanging something to helpthe water test proves this stageidea that you are the most important thing everobject_________ (if I cant see it, its not real)

The brain of a computer, 2014-06-10

4 Items: RAMCPUROMHDD

How Nicotine Affects the Teen Brain 2023-09-21

5 Items: nicotinedopaminesymptomsaddictionwithdrawal

Alcohol Word Search 2024-10-31

13 Items: "The shakes"____ use disorderMedical emergencyBind to GABA receptorsChronic Memory DisorderBlocks opioid receptorsHelps maintain abstinenceCalms autonomic hyperactivityAcute & reversible brain disorderCan be generalized or Tonic-ClonicTypically synonymous with Alcoholics Anonymous____ happens after reducing or quitting alcohol...

Anime 2023-12-04

20 Items: ...RAIDBaldGojoQuirkyGuildsnichirinStretchy manLord of deathDeath by deathNature's BeautyIts big brain timeLets try this again3 superhumans and a dogwalls, walls everywhereFighting fire with fireI don't remember a lie tbhNot as scary as it could have beenitsumo hitori de aruiteta furikaeruMan this teacher is a little too nice

Inhalants Word Search 2022-10-13

13 Items: Street nameStreet nameMedical nameMedical nameAn effect by inhalantsInhaling from a soaked clothInhalants cause ________ damageproducts An example of inhalantsInhaling directly from the productInhaling from paper or plastic bagProvides local treatment locationsFirst time users might experience thissystem This system of the brain is affected

Disease, Spread, and Containment 2024-11-01

80 Items: FluBuboColdRashLungSARSFeverMumpsVirusStoolTumorSinusLiverBrainHeartGalenSkullPolioFungusLesionCancerVectorGenomePlaqueKidneyCowPoxBleachCholeraSymptomRubellaMeaslesBladderProteinVaccineCarrierBirdFluAnatomySmallPoxShinglesBacteriaLeechingInnerEarExcrementLymphnodeRadiationViralLoadSymbioticSpinalTapDysenteryDiphtheriaChickenPoxHemaglobinSpinalCord...

Ap Psych Terms 2023-12-19

13 Items: founder of behaviorism theoryfounder of the learned helplessness theorythe study of how meaning is stored in the mindplays a role in digestion and hormone regulationkeeps body in homeostasis and controls hormone levelspeople either develop strong relationships or are alonethe spiral cavity in the inner ear that responds to sound vibration...

The Human Body 2023-11-06

13 Items: helps us seeLargest organhelps us heargrows on skinhelps us tastecontrols the bodyaround 5 feet longaround 20 feet longin the shape of beanscan hold 2 cups of urinepumps blood through the bodyThe only organ that can regrow itselfbreathe in oxygen and out carbon dioxide

Human Body Systems 2023-05-08

11 Items: provides movementsends messages as hormonestransports blood through bodyprotects the body from diseasebreak down and absorbs nutrientsfilters blood and excretes wastemakes hormones, egg and sperm cellstransports oxygen and carbon dioxideprovides structure, makes blood cellsfancy system name for the skin, hair, nails...

Julianator 2013-07-19

91 Items: catdogCATDOGFUNHUGONEOWNlionCARDCLAYFILEFREELOVEMAILMAKEMINDNAMEPINEPLAYSTARSURFTREEYOURzebrahippoBEACHBRAINCHILDFIGHTGLASSHORSEJULIALAUGHLIGHTMOMMYNIGHTPAPERSHARKSHAYASHELLSNAILSTATETODAYTOHARVIDEOANIMALBRANCHCASTLECIRCLECREATEFAMILYFLIGHTHAWAIIHEIGHTINDIANISLANDJEWISHNOTICEPLANETPURPLEPUZZLERANDOMSCHOOLSUMMERBLANKETEXPLOREFITNESSFOLDERSPASSION...

Testing Krkn 2022-10-15

92 Items: netjvagymhotcatssuitmeowrainkissgiftcoldfallcozyringbookloudcuteshoesrivertrainheartbrainhandsflameplanemusicwatchpockyanimemoviespicynekomagamingbridgeoxygenbananapaellakittentravelhoodiefluffysecretearbudcollarsummerspringwinterleavesprettylovingjokingdinnerconnectgravityreunionrunningpuddingyoutubehoodiespokemonblockedbicyclesweaterwalking...

Atoms Word Search 2023-07-27

90 Items: atomspresslyingbasisclocktastegrowsthankstormagreebraintracksmilefunnybeachstockhurrysavedsorrygianttrailofferoughtroughdailyavoidkeepsthrowallowcreamlaughedgesteachframebellsdreammagicoccurendedchordfalseskillholesdozenbraveappleclimbouterpitchrulerholdsfixedcostscallsblankstafflaboreatenyouthtoneshonorglobegasesdoorspoleslooseapplytearsexactbrush...

Atoms Word Search 2023-07-27

90 Items: atomspresslyingbasisclocktastegrowsthankstormagreebraintracksmilefunnybeachstockhurrysavedsorrygianttrailofferoughtroughdailyavoidkeepsthrowallowcreamlaughedgesteachframebellsdreammagicoccurendedchordfalseskillholesdozenbraveappleclimbouterpitchrulerholdsfixedcostscallsblankstafflaboreatenyouthtoneshonorglobegasesdoorspoleslooseapplytearsexactbrush...

Welcome Word Search 2023-09-26

5 Items: a look aroundto the internetthat brain of your can think of can be foundgot mountains of content some better some worsenone of it's of interest to you youd be the first

Puzzle 2023-11-09

7 Items: Abundant noble gasItalian coffee dessertOrigin of gouda cheeseDirector who likes feetFlorida license plate fruitThey have blue blood, three hearts and a doughnut-shaped braingolf tournament that Tiger Woods won by 12 strokes cementing his first-ever major championship win

human system word search(chen jye) 2024-06-03

5 Items: digestion ends thereit softens your foodit plumps out blood for your bodysystem it is a system that helps you digest your foodit protects your brain and it is part of your skeletal system

Vocabulary 3 2024-09-23

12 Items: to besiegeof relating to the brainmelodious, soft, soothinghard, difficult, tiresomeenvironment or surroundingsoverly dramatic, theatricalto catch in or as if in a tripshocked, frightened, terrifiedreminiscent of or pertaining to a pigcutting, incisive, caustic, sarcasticthe act or practice of recalling the past...

Tycoons Word Search 2024-08-12

100 Items: sreawsmazeyogikongtumiottoebayvyasarigelbraintigeradminprismasanafigmaslackcrocsboschmacyshupunrockettitansjarvisyoddhaempirespartanomadsnodejsgithubtableupythonkeeperraybanstancethorneamazonlazadatiktoktargetkrogertycoonsaarohanutkarshphoenixfinancereactjsworkdayairflowposticodbeaverdatadogpostmanthreepnclickupchatgptsidekiqshopifywalmartbestbuy...

Fall24 2A Vocabulary 2024-12-20

103 Items: IanVetHayFlyPawLeoBeeSeanSandMissSkinSodaWearPourKiwiHourGiftBowlPurrLickBackHearThinHardSoftGameFeelMoveSpinGrowBallHairHelpBarkFireWorkBeachMangoBrainDrinkRainyStormMoneyJapanCrossClosePaintClimbTasteSnakeSmellHairyRoughBlockTrickClownWheelCatchSmellMasonSummerBananaOrangeShouldFreezeGloriaOliviaSneezeHungryWindowStripeKittenJasperTongueSpider...

PSY 252 Exam 1 Word Search 2024-09-17

10 Items: portrayal of how gene expression is altered by external factorsa prediction or hypothesis in describing gene alteration and it's causesthe division of the cortex based on functionality in terms of characteristicswhen discussing drug use, the interference in natural motivational effectiveness...

CMHA 2024 Word Search 2024-04-26

102 Items: joycalmcarefawnfearlifemindangerbrainfightgriefguilthappyissuemusicpowershamesleeptiredwaterworryafraidenergyfamilyflightfreezehealthmentalnaturephobiaregretscaredserenestigmaanxiousbalancebenefitburnoutcomfortcontentexcitedfriendsillnessnervouspleasedproblemreadingrelaxedrespectroutinesadnesssuccesssupporttalkingtherapywalkingattitudecapacity...

Mental Health Week Word Search 2023-04-20

100 Items: joyfearcalmmindlifefawncareangertiredguiltshameworryhappygriefissuerelaxsleepwaterfightmusicbrainmentalhealthscaredafraidsereneregretphobiastigmafamilynatureflightfreezeenergysadnessnervousanxiousexcitedpleasedcontentrelaxedcomforttherapyillnessrespectproblemsupportroutinebalancetalkingfriendswalkingreadingburnoutsuccesseveryoneemotionsstrength...

Complications 2024-12-11

16 Items: what causes DMDcaused by abnormal brain developmentdiagnostic test for plantar fasciitisligament between heal and phalanges is inflammedantibodies block signals between nerves & musclesabbrev. of disorder due to the lack of dystrophintest used to examine how damaged someone's muscle cells are...

Fall24 2A Vocabulary 2024-12-20

104 Items: IanVetHayFlyPawLeoBeeSeanSandMissSkinSodaWearPourKiwiHourGiftBowlPurrLickBackHearThinHardSoftGameFeelMoveSpinGrowBallHairHelpBarkFireWorkBeachMangoBrainDrinkRainyStormMoneyJapanCrossClosePaintClimbTasteSnakeSmellHairyRoughBlockTrickClownWheelCatchSmellMasonSummerBananaOrangeShouldFreezeGloriaOliviaSneezeHungryWindowStripeKittenJasperTongueSpider...

Cardiovascular and Lymphatic Systems 2024-12-17

20 Items: transports oxygencontains hemoglobinpumps blood and oxygenfights against infectionThe top chambers of the heartthe lower chambers of the hearta microorganism that causes diseasethe oxygen-carrying protein in bloodvessel that returns blood to the heartclear fluid that fills the spaces around body cells...

Heart Word Search 2024-05-21

15 Items: the "blue blood"the gas we exhalehow you feel thingsblood the red bloodthe lightest elementthe gas we breath withmain organ in your bodythe thing you breath withcarry blood to your hearthow you see with your eyesthe things that produce airthe largest organ in your bodythe smallest organ in your bodyThe main liquid that you have to drink...

Word Search 2022-11-13

20 Items: Wry neckSkin-peelingEye prophylaxisPale color of skinFanning of the toesSluggish blood flowAccumulation of bloodAssesses gestational ageThin, slimy, more wateryDisappears at 12-18 monthsHeat loss via indirect contactInability to control temperatureMovement of the involved extremityGlistening cysts on the hard palate...

animal word search 2023-05-10

104 Items: nobinfeegiveriskallybeancoalselfleaklikewagenotetooltripmarsdraggoldmaskranchguestcolorforgeleaselimitclickwritebrainwomanorderarenabravefruitfaintotherriflesnarljudgetribeejectmiddlecorpseapathystridehammermanualcenterfingerchangelabourkidnapnumberlettergroundtissueenergyopposebudgetsupplystrikedefendfriendformatbuckettenderqualitytributetrivial...

Protocol 16-18 Word Search 2024-02-09

16 Items: T=_ hoursBlood in the irisProblem Suffix = JProtocol for FallsProtocol for HeadachesAnother word for BleedingProtocol for Eye ProblemsInfection around the brain_Blow is a Severe Eye InjuryConsidered a small event in dispatchOften called Arc Eye or Welder's FlashMost recognized method in airway control_ lenses are considered a minor eye injury....

If ur able to crack the code then ur BUG BRAIN! 2024-11-09

8 Items: 💀Fi💀🩵Maryn🩵✨Angie✨🎀Siler🎀😈Yelled😈😭Makayla😭🤩ADOPTED🤩🫥Scaremed🫥

Human system word search Sophia 2024-06-01

8 Items: protects the brainprotects the heart and the lungsinvolved in the exchange of gasesabsorbs water from undigested foodbreaks down food into simpler subtancesthe end of the journey for digested fooda long tube that pushes down food from the mouth to the stomachtransports food, water and mineral salts to other parts of the body

Vocabulary Week 13 2024-05-13

5 Items: Something that does not feel good.To know what is right and doing ita tool that is used to collect informationParts that are inside of the body like the heart and brain.A pin, patch, or ribbon that shows someone's job or accomplishment.

Brain Word Search 2024-08-14

1 Item: brain

Acromegaly 2024-09-12

13 Items: Causes a ( ) of the voiceCauses the skin to be ( )What is a secondary symptom?pituitary Released from which gland?what is a complication of the condition?What category of tumour (hint: glandular)Most commonly caused by a ( ) tumourAfter the growth plates have closed or opened?Excess production and release of ( ) hormone...

Brain Word Search 2024-10-10

1 Item: brain

Brain Word Search 2024-08-15

1 Item: Brain

TTS WS-1 CPRO 2024-05-23

19 Items: Desktop RAMNotebook RAMStorage DeviceStorage DeviceTells Hardware What To DoSends Signals To ComputerThe "brain" of a computerDrive has no moving partsSends Signals From ComputerSoftware needed to run hardwareDisk Drive that has moving partsSoftware embedded on hardware chipIs A Paper-Weight without SoftwareAdvancement over the traditional BIOS...

DaffyNitions 2023-03-03

20 Items: heart muscleWithout feverlow blood sugarsecretes hormonesessential for lifedifficulty breathinga severe brain injuryopposite of supinationA common form of dementiasmall skin burrowing mitespersonal protective equipmentrefers to the skin as a systemWhen muscles shrink and contractwhen cancer spreads to another area...

Brain Word Search 2024-08-18

1 Item: Brain

POSTIES 0909 COVER 2024-07-23

6 Items: another word for "error"doing several things at the same timea thing that takes your attention away from what you are doinga thing that you are given because you have done something goodSome apps can help you stay focused by blocking games and _____.To help your brain stay sharp, take a short rest for _____ minutes every 20 minutes.

trs22 5b bt4 wk18 pt1 2022-06-23

10 Items: n. A thing.n. Make something new.n. A picture of a person or people.n. A person who looks after plants.n. Person who discovers new places.n. Find a new place or new information.n. It's hard and surrounds an object to protect it.adj. Soft and fluffy, covered in lots of little hairs.n. The part of your brain that thinks of creative ideas....

The brain of a computer, Volatile storage, permenant storage 2014-06-10

4 Items: RAMCPUROMHDD

EscapeRoomWordSearch 2022-07-10

18 Items: Tongue’s senseMother's sisterPooh’s nervous friendShifting tectonic platesAmerica has fifty of theseWicked and Hamilton are thisWhat the wicked witch defiesLoves lasagna, hates MondaysFirst word of leprechaun cerealCoat that can only be put on wetLives in an underwater pineappleWhere today comes before yesterdayOff to see the wizard to get a brain...

Maybe Man 2024-06-07

12 Items: 'One, two, __ Here I go again''In some other life, I'd be __''If I was __ or a bottle of __''If I was __ or a bottle of __''Wish I were my __ out on the lawn''I wish I could __ in a show on TV''Wish I was a __, your favorite one''I wish I was __, as __ as my house''I wish I was __, I'd never trip up''I wish I was a __ so I couldn't feel'...

Typhus Word Search 2022-11-16

34 Items: three dotsPost-war illnesspunctuation markSite of personalitySprouting seedlingssubtitle (one word)modern narrative stylemovie title (one word)Site of the Stone Dancetrigger of flight for coverSite of the nuclear accidentDirect opposite of somethingprotein one fears to consumeexperience of Charlotte Wolfdead fish that move when cut...

OCR GCSE Computer Science Revision Part 1 2023-03-19

13 Items: base 16 number systemunits for sample ratemost common character setSecondary storage used as extra RAMType of storage used in a hard diskStart-up instructions stored in ROMnumber of bits for each sound sampleType of computer that has a specific purposeStores the result of calculations in the ALUThe physical components that make up a computer system...

Broad Exhibit Word Search (2.1) 2024-05-01

18 Items: To adjust optimallyGenetic informationThe engine of the bodyPeople who live in EuropeTo easily spread among othersRemoves waste from your bloodA group of interacting peopleWhen a disease can be transmittedmicroscopic unicellular organismsA illness that causes organ failuresends signals to and from the brainA disease that is caused by mutated cells...

Activity and Me 2024-04-09

15 Items: You’re never too old to _____.High blood pressure is known as _____.Swelling of the legs is known as _____.Weight bearing exercises help prevent _____.A disease affecting how your body uses sugar.Meditation is good for ______ and relaxation.Matching games are a fun way to improve _______.Being ______ is good for both your body and mind....

Parts of a Computer 2024-10-26

17 Items: The hard disk drive.gives the computer powerstores data not being used.also known as the audio card.Also known as volatile memory.port for using USB accessoriescamera attached to the monitor.displays the video, image, and text.often called "the brain" of the computer.cord to connect the computer to ethernet....

Anatomy & Physiology-Bones (Milady Esthetics) 2024-06-04

30 Items: aka digitsback of the neckbone forming the foreheadbones that form upper jawforms sides of eye socketform the bridge of the noseform the sides and top of craniumconnection between 2 or more bonesoval, bony case that protects the brain12 pairs of bones forming wall of thoraxaka collarbone; joins sternum and scapula...

Parasitism Word Search 2023-03-24

9 Items: Symbiotic relationship in which both organisms benefitThe ____ system allows you to respond to your environment.The _____ system is responsible for making your body move.The _____ endocrine system regulates your body with different hormones.Symbiotic relationship in which one organism benefits, and the other is harmed...

Vegetables and Fruits 2024-12-31

9 Items: What is the hydrating fruit that is 92% water?Which berry is known for improving memory and brain health?What fruit contains an enzyme called bromelain that aids digestion?What cruciferous vegetable is known for its detoxifying properties?Which leafy green is packed with vitamin K and helps in blood clotting?...

March 2024 Ambassador Word Search 2024-03-11

20 Items: Basic unit of digital informationProgramming instructions for softwarePattern recognition through algorithmsAdvanced neural network-based learningProcess of acquiring knowledge or skillsExtraction of insights from large datasetsA specific job or assignment to be completedField involving automated machines and systems...

Choice Word Search 2024-11-11

19 Items: an apartment buildinghow heavy something isstories, poems and playsdepartment that sells productspersuade someone to by somethingunit of measuring liquid in Europeopportunity to decide between optionsowned/ used by someone else before meworried that something bad will happenunit of measuring liquid in the UK and US...

Respiratory System 2022-09-12

28 Items: chestblood clotsuffocatingtaking in of airnormal breathingvocal apparatus of larynxanother name for windpipeinflammation of the lungsinflammation of the larynxair or gas in chest cavityplastic surgery on the nosemembrane surrounding each lungtemporary absence of breathinganother name for auditory tubelabored or difficulty breathing...

Spring into Security 2024 Word Search 2024-02-14

20 Items: Basic unit of digital information.Programming instructions for software.Pattern recognition through algorithms.Advanced neural network-based learning.Process of acquiring knowledge or skills.Extraction of insights from large datasets.A specific job or assignment to be completed.Field involving automated machines and systems....

Parts of the Computer 2024-11-05

9 Items: This is the brain of the computerThis is a camera for the computerThe part of the computer that has the screenAn input device that allows you to select things on the screen.It is an input device that allows you to write letters and numbersAllows a group of people to hear the sound coming from the computer...

Recap Unit 9 2024-11-11

19 Items: an apartment buildinghow heavy something isstories, poems and playsdepartment that sells productspersuade someone to by somethingunit of measuring liquid in Europeopportunity to decide between optionsowned/ used by someone else before meworried that something bad will happenunit of measuring liquid in the UK and US...

Structures and Functions of Animals 2023-12-13

10 Items: Animals eat other __________ to get energy.A _________ is where an animal makes its home.Traveling in herds is a type of _____________ adaptation.Fish use ______ to exchange gases with the water that surrounds them.The ability to run fast is an example of a ______________ adaptation....

Skylar P. Halloween Crossword Puzzle 2024-10-31

15 Items: The season after springWhat protects your brainCommonly worn at a masquerade partyThe creation of spider to catch foodAll that we have left after a body rotsUsually seen with a broom and a cauldronThis is usually associated with werewolfsThe place where dead loved ones are buriedThe day after all Hallow's Eve in Catholicism...

Computer Hardware Vocabulary 2024-10-28

11 Items: Provides electrical power to the components in the computer.A dedicated card for handling graphics rendering and processing.A standard interface used for connecting external devices to a computer.A wireless technology used for short-range communication between devices.The main circuit board that connects and holds various hardware components....

Organs of the body 2023-01-20

1 Item: lungs,kidneys,large intestine, spleen, liver, stomach, brain, bladder, skin, small intestine

G8 - Cells & Systems Vocab. 2022-11-14

38 Items: what something doesthe brain of the cellhow something is shapedmade up of only one cellstores water in the cellmade up of more than one cellan organ system that creates lifethere are 4 of these in your heartan organ system that helps you moveAll cells come from __________ cellskeeping a body's internal conditions stable...

Milady Anatomy & Physiology : Glands 2023-06-21

11 Items: Most complex organ of the endocrine systemPlays a major role in sexual development, sleep, and metabolismFunction in sexual reproduction as well as determining male and female characteristicsFunction in sexual reproduction as well as determining male and female characteristics...

jeffery dahmer word search 2024-12-15

10 Items: Milwaukee: where most of his killings wereSkulls: one of the many forms of souvenirs he keptLobotomy: performed on victims to make them "zombie-like"Photographs: he would take pictures of his victims as a mementoSouvenirs: he often kept body parts and other mementos of his victims...

D&S WORD SEARCH 2023-03-07

25 Items: Brachialan artificial limbopposite of flexioncrippling arthritismedical term for fartfree from contaminationverbal threat to cause harma microbe that causes diseasethe side not affected by strokeviolence that occurs in the homeosteo is one form of this diseasea brain disorder that causes seizuresthis health care provides comfort care...

Organs so scary yet so cool! 2024-07-19

11 Items: Organ storing urine before it is excreted from the body.Digestive organ where food is broken down and mixed with digestive enzymes.Pair of organs involved in respiration, exchanging oxygen and carbon dioxide.Long, coiled organs where nutrients and water are absorbed from digested food....

Unit 3 Spelling Word Search 2023-02-21

1 Item: shock, sloth, thought, where, which, stray, plain, brain, weight, neighbor, great, break, eagle, breathe, believe, freeze

x 2023-02-03

191 Items: menasddsmmomdadsonhugpopseesawyouonetwokinnewoldfunaceawekeylabpepskyvexwaywhywhowrytoyslyspyorbactadohexeastwestalpsmaleboysadhdpureshutmemegoodfineauntcarenicekindloveaxispingpeekpokefeelfeltfaceseekwisegemsgoalminemindmorejustkindsingplaygamebossusedfreefunkheadopenwhennorthsouthbraingirlswomenloyaleagertruthplainquickshortreadyalertrulesblush...

Week 19 Thursday 2024-02-11

25 Items: adultsthoughtto knowunable to speakto previously fightable to do somethinghaving the same valuemaking a lot of noisepertaining to the brainimpulsive and unpredictableA break in the earth's crustto get or gain through some effortto think that something will happena piece of land surrounded by waterwilling to wait without complaining...

Week 20 Thursday 2024-02-11

25 Items: adultsthoughtto knowunable to speakto previously fightable to do somethinghaving the same valuemaking a lot of noisepertaining to the brainimpulsive and unpredictableA break in the earth's crustto get or gain through some effortto think that something will happena piece of land surrounded by waterwilling to wait without complaining...

Computer Definitions 2023-11-09

12 Items: Phishing - A type of email/message sent by scammersMouse- A small device that allows us to point and clickBackspace - the key used to delete letters to the left.Email - A electronic message sent through the internet.Attachments - Files or photos that are added to a email.Printer - A device used to print paper copies of a document....

Brain Health Word Search 2024-03-21

1 Item: Cortex, Macromolecules, Neurotransmitters, Cerebellum, Temporal Lobe, Hippocampus, Occipital Lobe, Biomolecules, Parietal Lobe, Frontal Lobe, Neurons, Cognitive, Fatty Acids, Vitamin D, Vitamin B, Amino Acid, Amygdala, Anatomy, Omega, Protein, Lutein, Mem

final 2024-12-18

20 Items: a band of nerve fibersthe process of chewinga curvature of the spineinflammation of the sinuslongest and strongest boneinflammation of the appendixthe liquid component of bloodsecond largest part of the brainan illness that affects the lungscells that prevent the body's loss of bloodthe number of times your heart beats per minute...

Algorithm Word Search 2023-04-06

10 Items: What is the study of meaning in language called?What is a spoken word, phrase, or sentence called?What is a group of similar data points or objects called?What is a set of step-by-step instructions for solving a problem or performing a task called?What is a system of communication used by humans, including spoken, written, and sign, called?...

Cell Organelles 2023-09-12

14 Items: Two organelles that work to help the cell divide.Storage bins where food, nutrients, or waste are kept.Sphere shape in the nucleus. Makes ribosomes for the ER.Flexible material that holds the parts of the cell together.The brain of the cell that controls eating, movement, and reproduction....

Memory Game 2024-11-13

15 Items: store specializes in visual and spatial informationmemory stores auditory information coming from the earswhich memories become fixed and stable in long-term memorythe repetition of information that has entered short-term memoryThe initial, momentary storage of information, lasting only an instant...

CHAPTER 2: KNOWING HOW YOUR BODY WORKS 2024-08-27

1 Item: endocrine system, neuron, arteries, epidermis, pancreas, bladder, gallbladder, pituitary gland, body system, heart, plasma, brain stem, hypodermis, respiration, bronchi, integumentary, respiratory system, capillaries, joint, skeletal system, cerebellum, k

tester23 2023-03-18

245 Items: codaâmeartbiochidayareaauraautoâyurbachbodycampcodecoldcropdéfidéjàdénidheaalphaamwayangesappelarchebaccibiaisbiblebijoubonneboulebrainbrownbyrnecayceclarkcordecorpscourscultedabicdébutakashaanoxieapportarchéoashtarastralavatarbamboubarnumbarronbetterbrightbunyipbuttarcabalecannoncartescasquecécitéchaînechampscharmecherrychopraclimatcônagecrânes...

"Pool Ball Adventures" Word Search 2024-04-10

42 Items: MMM.Causes strife.Utahraptor puppet.What we love most.Rhymes with "lice".No sense. Deep web.Where YOU should go!Troubled monster clown.The world's worst band.Something nobody wants.Pops if you have a cat.A nice and friendly man.Large species of raptor.Make your "fanimations".A very, very, racist guy.Don't lie. You like this....

Topic 6 DEVELOPMENT OF HARDWARE, SOFTWARE & TELECOMMUNICATIONS SYSTEMS 2024-05-02

21 Items: The brain of a computerSemiconductor materialsThe delivery of computing servicesMaterials that have a conductivityA set of recognizable and verifiable dataThe capacity of a device to hold and retain dataPhysical components of a computer that you can touch and see.Set of instructions and programs that tell a computer what to do...

LA 2023-10-25

21 Items: Poor balance and coordination:________Involuntary, uncontrolled movement:__________This type of spina bifida is the most severe:________Pre-, peri- or post-natal brain hypoxia:________ ________Velocity-dependent resistance to passive stretch:________Joint stiffness and deformity as a result of fetal akinesia...

EV3 Robotics Vocabulary 2023-05-09

16 Items: to take apart.provide linear mobility for a robot.detects rotational motion on a single axis.any command or group of commands in a program.to build by putting parts together; to build; to create.specific areas for connecting sensors and motors to the EV3.the primary source of physical motion in the Mindstorms EV3system....

Ambiguity Word Search 2024-12-04

12 Items: This exists when something can have more than one interpretation.______Ambiguity is present when a sentence has two possible tree structures.occurs when a word that has different meanings that derive from a common originthe aspect of a verb which indicates that an event/action is proceeding or on-going...

CVA Review Game 2024-01-05

16 Items: Pertaining to the heartAnything that makes a substance unusable for its intended purpose.Section Delivery of fetus by incision through the abdominal wall and uterine wall.Pertaining to the cranium or the head end of the body, or anterior end of the body.A light proof housing for X-ray film, containing front and back intensifying screens....

Breed Word Search 2024-01-05

16 Items: Pertaining to the heartAnything that makes a substance unusable for its intended purpose.Section Delivery of fetus by incision through the abdominal wall and uterine wall.Pertaining to the cranium or the head end of the body, or anterior end of the body.A light proof housing for X-ray film, containing front and back intensifying screens....

Cells Word Search 2024-05-21

15 Items: the smallest unit that can live on its own.provide support and movement to the soft tissues.a type of fibrous connective tissue that links your muscles and bonesA type of blood cell that is made in the bone marrow and found in the blood.a type of eukaryotic cell that lacks a cell wall and has a membrane-bound nucleus...

body 2024-03-09

1 Item: eyes them aside face and desecrate arms legs get in the way hands theyll understand heart pull it apart take brain what remains throw all away cause Ive grown tired of this body cumbersome heavy lungs run tongue go have some fun ears disappear joints for

Units 42-43 Sheet 4 2024-01-01

38 Items: (feminine) the itch, itching(masculine) the (male) nurse(neuter) the (anatomy) bloodto be of interest, interests(neuter) the (animal) octopus(masculine) the (animal) frog(neuter) the court, court roomto vote  (rel, to elect) εκλέγω(feminine) the freedom, liberty(masculine) the (anatomy) brain(masculine) the (anatomy) shoulder...

Lemon tree 2024-12-01

20 Items: Boring. (adj). Not interesting; causing boredom.Rainy. (adj). Characterized by rain or frequent rainfall.Feel. (v). To experience an emotion or physical sensation.Far. (adj). At or to a great distance in space, time, or degree.Fast. (adj/adv) Moving or capable of moving quickly; also refers to speed....

Histology 2024-12-11

47 Items: Osteocytes - Bone cellsChondrocytes - Cartilage cellshistology - the study of tissuesNeurons - Make up 10% of nerve cellsGoblet Cell - Cells that secret mucusNeuroglia - Make up 90% of nerve cellsFibrocytes - Connective Tissue Proper cellsSpongy Bones - A spongy type of bone tissueCompact Bones - A compact type of bone tissue...