brain Word Searches

Julianator 2013-07-19

91 Items: catdogCATDOGFUNHUGONEOWNlionCARDCLAYFILEFREELOVEMAILMAKEMINDNAMEPINEPLAYSTARSURFTREEYOURzebrahippoBEACHBRAINCHILDFIGHTGLASSHORSEJULIALAUGHLIGHTMOMMYNIGHTPAPERSHARKSHAYASHELLSNAILSTATETODAYTOHARVIDEOANIMALBRANCHCASTLECIRCLECREATEFAMILYFLIGHTHAWAIIHEIGHTINDIANISLANDJEWISHNOTICEPLANETPURPLEPUZZLERANDOMSCHOOLSUMMERBLANKETEXPLOREFITNESSFOLDERSPASSION...

Cerebral Palsy Word Search 2025-10-29

10 Items: Primarily affects the legsAffects ONE side of the bodyInvoluntary twisting posturesThe affected part of the brainAbnormally low muscle tone (Floppy)Causes poor balance and coordinationSlow, Involuntary twisting movementsThe most common type of Cerebral PalsyWhat people with Cerebral Palsy experienceThe most severe type that affects ALL FOUR LIMBS

Welcome Word Search 2023-09-26

5 Items: a look aroundto the internetthat brain of your can think of can be foundgot mountains of content some better some worsenone of it's of interest to you youd be the first

Puzzle 2023-11-09

7 Items: Abundant noble gasItalian coffee dessertOrigin of gouda cheeseDirector who likes feetFlorida license plate fruitThey have blue blood, three hearts and a doughnut-shaped braingolf tournament that Tiger Woods won by 12 strokes cementing his first-ever major championship win

Body Systems/Tissues 2025-11-20

15 Items: The control center of the bodybring in oxygen and remove co2pumps blood throughout the bodyremoves old or damaged red blood cellsfilter out vitamins, minerals, and nutrietsThe removal of waste products from the body.breaks down food with muscle contractions and acidThe release of useful substances produced by cells or glands....

Vocabulary 3 2024-09-23

12 Items: to besiegeof relating to the brainmelodious, soft, soothinghard, difficult, tiresomeenvironment or surroundingsoverly dramatic, theatricalto catch in or as if in a tripshocked, frightened, terrifiedreminiscent of or pertaining to a pigcutting, incisive, caustic, sarcasticthe act or practice of recalling the past...

human system word search(chen jye) 2024-06-03

5 Items: digestion ends thereit softens your foodit plumps out blood for your bodysystem it is a system that helps you digest your foodit protects your brain and it is part of your skeletal system

Came, Word Search 2025-07-24

3 Items: moistlate, plane, shape, plate, skate, snake, bravedrizzle, fuzzy, fuzz, dizzy, train, paint, chain, brain, again, snail, oil, point, spoil, joint,

PSY 252 Exam 1 Word Search 2024-09-17

10 Items: portrayal of how gene expression is altered by external factorsa prediction or hypothesis in describing gene alteration and it's causesthe division of the cortex based on functionality in terms of characteristicswhen discussing drug use, the interference in natural motivational effectiveness...

Mental Health Week Word Search 2023-04-20

100 Items: joyfearcalmmindlifefawncareangertiredguiltshameworryhappygriefissuerelaxsleepwaterfightmusicbrainmentalhealthscaredafraidsereneregretphobiastigmafamilynatureflightfreezeenergysadnessnervousanxiousexcitedpleasedcontentrelaxedcomforttherapyillnessrespectproblemsupportroutinebalancetalkingfriendswalkingreadingburnoutsuccesseveryoneemotionsstrength...

Smart Word Search 2025-08-07

100 Items: PenBayEyeDogSynSunLovePinkBackFakeBallBlueViewBakeTurnBookBeerDareRainDareHopeHomeRiseFeelCalmSmartPhoneSmileAppleLaughDreamHappyValidBlackWriteBrainBreadMusicHeartEnterDrinkPaperDailyHungerDesireHumbleSearchCoffeeDragonEnergyFamilyMobileHealthVanillaHonestyFreedomMindfulForgiveMessageNumbersCorrectBelieveBlessedFingersCompanyExamplePaymentRespect...

All About School 2025-09-25

100 Items: ArtBusGymLabBandBookDeskGlueIdeaMathPoemQuizSTEMTapeTestAngleBoardBrainChairChartClassEarthEaselEssayLunchModelMusicNurseNotesPaintRulerStudyAnswerBinderCircleCrayonDesignEnergyFolderFrenchLaptopLessonMarkerOfficePencilRecessAlgebraBiologyCookiesEnglishHallwayHistoryJournalLibraryLockersPolygonProblemPrinterScienceSpanishStaplerTeacherBackpack...

CMHA 2024 Word Search 2024-04-26

102 Items: joycalmcarefawnfearlifemindangerbrainfightgriefguilthappyissuemusicpowershamesleeptiredwaterworryafraidenergyfamilyflightfreezehealthmentalnaturephobiaregretscaredserenestigmaanxiousbalancebenefitburnoutcomfortcontentexcitedfriendsillnessnervouspleasedproblemreadingrelaxedrespectroutinesadnesssuccesssupporttalkingtherapywalkingattitudecapacity...

BENJIS FIVE LETTER WORDSEARCH 2025-02-03

100 Items: AlbieAlfieBenjiLucasThreeAbbeyJesseJashyZestyTylerGraceHarisFartstonkyjamesEarthpoppynannynooooyessssevendiddytigervipersonicmusicmathskoreatrustloyalsharewhiteblackgreentableteachchairlionslightshinewhaleatomsgermsbrainskullheartthingkneeschilddaddymummyelliewavesstudynoveldailytimerfloordoorswhereappleberryissacreachprintothermarchaprilgamesmarks...

Christmas 2025-11-15

100 Items: ARTARMANTCARCUPDOGEGGEYEFANFOXHATICEINKJARKEYBIRDBOATBALLBOOKCOOKCAVEDOLLDOORDESKDEERDUCKFISHFROGFIREGATEGIFTGOATGAMEHANDHILLIRONIDEAJUMPKITEKINGKNEELAMPLEAFLAKELIONLINELOCKLOVEAPPLEACTORANGELAWARDBRAINCLOUDCHAIRCANDYDREAMDRESSEARTHEAGLEFRUITFENCEGLASSGLOVEGRASSHOUSEHORSEJUICEJEWELLIGHTLEMONANIMALAUTUMNBOTTLEBANANABASKETBUTTONBRIDGECANDLECIRCLE...

Fall24 2A Vocabulary 2024-12-20

103 Items: IanVetHayFlyPawLeoBeeSeanSandMissSkinSodaWearPourKiwiHourGiftBowlPurrLickBackHearThinHardSoftGameFeelMoveSpinGrowBallHairHelpBarkFireWorkBeachMangoBrainDrinkRainyStormMoneyJapanCrossClosePaintClimbTasteSnakeSmellHairyRoughBlockTrickClownWheelCatchSmellMasonSummerBananaOrangeShouldFreezeGloriaOliviaSneezeHungryWindowStripeKittenJasperTongueSpider...

Tycoons Word Search 2024-08-12

100 Items: sreawsmazeyogikongtumiottoebayvyasarigelbraintigeradminprismasanafigmaslackcrocsboschmacyshupunrockettitansjarvisyoddhaempirespartanomadsnodejsgithubtableupythonkeeperraybanstancethorneamazonlazadatiktoktargetkrogertycoonsaarohanutkarshphoenixfinancereactjsworkdayairflowposticodbeaverdatadogpostmanthreepnclickupchatgptsidekiqshopifywalmartbestbuy...

Complications 2024-12-11

16 Items: what causes DMDcaused by abnormal brain developmentdiagnostic test for plantar fasciitisligament between heal and phalanges is inflammedantibodies block signals between nerves & musclesabbrev. of disorder due to the lack of dystrophintest used to examine how damaged someone's muscle cells are...

Fall24 2A Vocabulary 2024-12-20

104 Items: IanVetHayFlyPawLeoBeeSeanSandMissSkinSodaWearPourKiwiHourGiftBowlPurrLickBackHearThinHardSoftGameFeelMoveSpinGrowBallHairHelpBarkFireWorkBeachMangoBrainDrinkRainyStormMoneyJapanCrossClosePaintClimbTasteSnakeSmellHairyRoughBlockTrickClownWheelCatchSmellMasonSummerBananaOrangeShouldFreezeGloriaOliviaSneezeHungryWindowStripeKittenJasperTongueSpider...

Cardiovascular and Lymphatic Systems 2024-12-17

20 Items: transports oxygencontains hemoglobinpumps blood and oxygenfights against infectionThe top chambers of the heartthe lower chambers of the hearta microorganism that causes diseasethe oxygen-carrying protein in bloodvessel that returns blood to the heartclear fluid that fills the spaces around body cells...

Heart Word Search 2024-05-21

15 Items: the "blue blood"the gas we exhalehow you feel thingsblood the red bloodthe lightest elementthe gas we breath withmain organ in your bodythe thing you breath withcarry blood to your hearthow you see with your eyesthe things that produce airthe largest organ in your bodythe smallest organ in your bodyThe main liquid that you have to drink...

If ur able to crack the code then ur BUG BRAIN! 2024-11-09

8 Items: 💀Fi💀🩵Maryn🩵✨Angie✨🎀Siler🎀😈Yelled😈😭Makayla😭🤩ADOPTED🤩🫥Scaremed🫥

animal word search 2023-05-10

104 Items: nobinfeegiveriskallybeancoalselfleaklikewagenotetooltripmarsdraggoldmaskranchguestcolorforgeleaselimitclickwritebrainwomanorderarenabravefruitfaintotherriflesnarljudgetribeejectmiddlecorpseapathystridehammermanualcenterfingerchangelabourkidnapnumberlettergroundtissueenergyopposebudgetsupplystrikedefendfriendformatbuckettenderqualitytributetrivial...

Word Search 2022-11-13

20 Items: Wry neckSkin-peelingEye prophylaxisPale color of skinFanning of the toesSluggish blood flowAccumulation of bloodAssesses gestational ageThin, slimy, more wateryDisappears at 12-18 monthsHeat loss via indirect contactInability to control temperatureMovement of the involved extremityGlistening cysts on the hard palate...

Nutrition Word Search 2025-11-24

10 Items: Keeps your body hydratedRed fruit that grows on treesCitrus fruit rich in vitamin CNutrient that gives our body energyMineral that helps build strong bonesCrunchy orange veggie good for our eyesNutrient that helps build and repair our musclesNutrient that is important for brain developmentFood group that includes milk, cheese, and yogurt...

Protocol 16-18 Word Search 2024-02-09

16 Items: T=_ hoursBlood in the irisProblem Suffix = JProtocol for FallsProtocol for HeadachesAnother word for BleedingProtocol for Eye ProblemsInfection around the brain_Blow is a Severe Eye InjuryConsidered a small event in dispatchOften called Arc Eye or Welder's FlashMost recognized method in airway control_ lenses are considered a minor eye injury....

Human system word search Sophia 2024-06-01

8 Items: protects the brainprotects the heart and the lungsinvolved in the exchange of gasesabsorbs water from undigested foodbreaks down food into simpler subtancesthe end of the journey for digested fooda long tube that pushes down food from the mouth to the stomachtransports food, water and mineral salts to other parts of the body

Vocabulary Week 13 2024-05-13

5 Items: Something that does not feel good.To know what is right and doing ita tool that is used to collect informationParts that are inside of the body like the heart and brain.A pin, patch, or ribbon that shows someone's job or accomplishment.

Internal Parts of a Computer 2025-01-16

7 Items: The system's short-term memory.The system's long-term storage.The computer's main circuit board.It is sometimes called the brain of the computer.It is responsible for what you see on the monitor.A device that cools the central processing unit (CPU) of a computer.It sends power through cables to the motherboard and other components.

4/15 Clues: Things related to myself or my PSP fam-line (as a whole or individuals within) 9 truths, 6 lies 2025-04-15

15 Items: pizza toppinga type of therapytrack stars (not me)Georgia state (Halloween)3rd year college studentshumanities study of the braininvestigating via experimentsrespiration (you heard me right)fighting grounds during war (hits home)not coffee but warm and made with leavesopposite of dogs (and objectively better)...

TTS WS-1 CPRO 2024-05-23

19 Items: Desktop RAMNotebook RAMStorage DeviceStorage DeviceTells Hardware What To DoSends Signals To ComputerThe "brain" of a computerDrive has no moving partsSends Signals From ComputerSoftware needed to run hardwareDisk Drive that has moving partsSoftware embedded on hardware chipIs A Paper-Weight without SoftwareAdvancement over the traditional BIOS...

HUMAN BODY SYSTEM 2025-12-02

38 Items: Tissues that enable movement.Another word for a nerve cell.Organs where blood gets oxygen.A muscular sac that stores urine.The strong muscle that pumps blood.The watery fluid part of the blood.The red fluid pumped throughout the body.The windpipe that carries air to the lungs.The main control center of the nervous system....

Senses and Sensory Receptors 2025-11-25

10 Items: Respond to lightRespond to temperatureRespond to different chemicalsRespond to body position and movementRespond to physical force (deformation)Respond to pain or the perception of tissue damageDiscomfort caused by injury or noxious stimulationpain Travels on unmyelinated fibers so the body responds slower...

Acromegaly 2024-09-12

13 Items: Causes a ( ) of the voiceCauses the skin to be ( )What is a secondary symptom?pituitary Released from which gland?what is a complication of the condition?What category of tumour (hint: glandular)Most commonly caused by a ( ) tumourAfter the growth plates have closed or opened?Excess production and release of ( ) hormone...

DaffyNitions 2023-03-03

20 Items: heart muscleWithout feverlow blood sugarsecretes hormonesessential for lifedifficulty breathinga severe brain injuryopposite of supinationA common form of dementiasmall skin burrowing mitespersonal protective equipmentrefers to the skin as a systemWhen muscles shrink and contractwhen cancer spreads to another area...

Brain Word Search 2024-10-10

1 Item: brain

Brain Word Search 2024-08-14

1 Item: brain

Brain Word Search 2024-08-18

1 Item: Brain

Brain Word Search 2024-08-15

1 Item: Brain

Modules 2 & 3 Review 2025-02-06

11 Items: Domain in which motor skills are included.These are detailed, objective, and accurate.Can be informal, formal, and can track benchmarks.Domain in which language and literacy are included.Domain referring to a child's ability to think & reason.Domain in which children develop autonomy or independence....

POSTIES 0909 COVER 2024-07-23

6 Items: another word for "error"doing several things at the same timea thing that takes your attention away from what you are doinga thing that you are given because you have done something goodSome apps can help you stay focused by blocking games and _____.To help your brain stay sharp, take a short rest for _____ minutes every 20 minutes.

AI & Testing 2025-10-28

8 Items: A tool used for tracking and managing defectsAlgorithm type inspired by biological evolution.The field focused on building intelligent systems.A type of testing performed without executing codeMeasures how much of the code is executed during testsPertaining to network architectures inspired by the brain....

A2 nouns 2025-05-15

120 Items: artskytopwarzoobeltbeanbowldirtdollfarmgoldkingkiteringsizesoapsoupwindwoodwoolwineyogazerozoomclockalbumbeardbeachbrainbrushchilicloudclownclonechainhoneymatchmetalpursequeensaucespacetitletoastwheelwasteyachtadviceartistbridgebucketcircusclosetcarpetcastledangerdrawerexcusefolderflowerhealthnatureposterstripebiscuitblanketbanquetbatteryballoon...

trs22 5b bt4 wk18 pt1 2022-06-23

10 Items: n. A thing.n. Make something new.n. A picture of a person or people.n. A person who looks after plants.n. Person who discovers new places.n. Find a new place or new information.n. It's hard and surrounds an object to protect it.adj. Soft and fluffy, covered in lots of little hairs.n. The part of your brain that thinks of creative ideas....

hard workscreach 2025-08-02

118 Items: UpHenAirCatDogBigSunMadSadLegArmCarMomDadgasHomeEggsPlusThinLongMoonCoolCuteOpenDownLeftNeckHeadHairNoseBoneOvalCubeStarCalmBikecarsSandWoodcityClayBackcycleMinusWaterSleepLarvaKittyPuppySharpShortSmallEarthPlutoAngryBirdsCloseRightHeartBrainHeartHappyGreenTreesTrainPaperGlassMetalSharpRocksAdultFrontFamilyCocoonSaturnMecuryCreepyShapesCircleRubber...

Alzheimer's Disease 2025-04-08

14 Items: lose track of thesemost common cause of dementiamay stop in the middle of thismay put things in ______placesmay experience a change in thisdifficulty completing these tasksdifficulty with this may cause fallsthis loss is one of the earliest symptomspart of body affected by alzheimer diseasemay become irritable when this is disrupted...

word search human organ 2025-11-04

8 Items: a healthy meal will be good to our?The brain helps us to _______ and control our body.The intestines absorb _______ from the digested foodThe heart pumps _______ through all parts of the body.to keep your whole body healthy you should take regular?to keep your lungs working well always try to breath a clean?...

The brain of a computer, Volatile storage, permenant storage 2014-06-10

4 Items: RAMCPUROMHDD

Memory Word Search 2025-12-16

6 Items: Mental shortcutsIntentionally looking for info that fits into what you thinkAllows us to think outside the box and look for innovative solutionsBrain's ability to take in, store, and recall info, experiences, or skillsBelieving you know more/are better at something than you are, leads to risky choices...

Maybe Man 2024-06-07

12 Items: 'One, two, __ Here I go again''In some other life, I'd be __''If I was __ or a bottle of __''If I was __ or a bottle of __''Wish I were my __ out on the lawn''I wish I could __ in a show on TV''Wish I was a __, your favorite one''I wish I was __, as __ as my house''I wish I was __, I'd never trip up''I wish I was a __ so I couldn't feel'...

Peer to Peer 2025-04-25

11 Items: Your school's mascotA smokeless tobacco productThe name of Lucas and Ray's catsThe addictive chemical in cigarettesThe part of a vape that contains the e-liquidThe more common name for electronic cigarettesThe name of your elementary school with no spacesThe part of the brain that controls decision making...

EscapeRoomWordSearch 2022-07-10

18 Items: Tongue’s senseMother's sisterPooh’s nervous friendShifting tectonic platesAmerica has fifty of theseWicked and Hamilton are thisWhat the wicked witch defiesLoves lasagna, hates MondaysFirst word of leprechaun cerealCoat that can only be put on wetLives in an underwater pineappleWhere today comes before yesterdayOff to see the wizard to get a brain...

Typhus Word Search 2022-11-16

34 Items: three dotsPost-war illnesspunctuation markSite of personalitySprouting seedlingssubtitle (one word)modern narrative stylemovie title (one word)Site of the Stone Dancetrigger of flight for coverSite of the nuclear accidentDirect opposite of somethingprotein one fears to consumeexperience of Charlotte Wolfdead fish that move when cut...

SAT Quack 7 2025-06-29

20 Items: ejecta lineaward or honordisregard for dangeroffensive; disgustingto gradually decreasehaving no room or spaceto one side; crooked; awryunquestionable; actual; trueexcessively decorated; elaborateat the same time; simultaneouslya harsh sound; harsh, disturbing noiseto obstruct or interfere with; to delayword for word; using exactly the same words...

How Good Is You're LONG-TERM Memory? 2025-05-22

12 Items: retaining informationlater get back the infogetting info into the brainspecial events that are emotionally chargedepinephrine released to emotional situationinability to remember prior to injury or diseasesituations with pos/neg effective tell over and overmore likely to recall items at the beginning of a list...

Algorithm Word Search 2025-10-27

12 Items: Phase where a model learns from data.A controlled procedure to test a hypothesis.Quantitative measures used to evaluate models.True output values used for supervised learning.Algorithm type inspired by biological evolution.To improve model performance by minimizing error.The field focused on building intelligent systems....

Broad Exhibit Word Search (2.1) 2024-05-01

18 Items: To adjust optimallyGenetic informationThe engine of the bodyPeople who live in EuropeTo easily spread among othersRemoves waste from your bloodA group of interacting peopleWhen a disease can be transmittedmicroscopic unicellular organismsA illness that causes organ failuresends signals to and from the brainA disease that is caused by mutated cells...

OCR GCSE Computer Science Revision Part 1 2023-03-19

13 Items: base 16 number systemunits for sample ratemost common character setSecondary storage used as extra RAMType of storage used in a hard diskStart-up instructions stored in ROMnumber of bits for each sound sampleType of computer that has a specific purposeStores the result of calculations in the ALUThe physical components that make up a computer system...

Waves Word Search 2025-05-28

12 Items: – A form of energy that helps us see things; it travels in waves. (L, 5 letters)– A lens that is thinner in the middle and spreads light rays outward. (C, 7 letters)– A dark shape made when something blocks light from reaching a surface. (S, 6 letters)– The range of colours that make up white light, usually seen as a rainbow. (S, 8 letters)...

Do You Get Enough Sleep? 2025-10-10

10 Items: Feeling easily annoyed or grumpyShort moments of forgetting or losing focusRelated to thinking, learning, and understandingThe body's natural defense against germs and sicknessA problem or damage that makes something work less wellThe ability to make smart decisions about right and wrongExtremely important or necessary for life, health, or success...

Control+F 2025-07-24

15 Items: The brain inside the boxIt holds data in a programFixing mistakes in a programSomeone who breaks into computersA rule that decides what happens nextRepeats a set of actions again and againIt mixes numbers with ABCs, and 16 is the keyClear thinking used to solve problems in codingThe main screen you see when the computer starts...

Medical Prefixes and Suffixes 2025-08-17

28 Items: Greek prefix for “chest” ____________________Greek prefix meaning “liver” _________________Greek prefix meaning “heart” _________________Greek prefix meaning “skin” __________________Greek prefix meaning “stomach” _______________Latin prefix for “vein” ______________________Greek prefix meaning “blood” __________________...

Activity and Me 2024-04-09

15 Items: You’re never too old to _____.High blood pressure is known as _____.Swelling of the legs is known as _____.Weight bearing exercises help prevent _____.A disease affecting how your body uses sugar.Meditation is good for ______ and relaxation.Matching games are a fun way to improve _______.Being ______ is good for both your body and mind....

Parts of a Computer 2024-10-26

17 Items: The hard disk drive.gives the computer powerstores data not being used.also known as the audio card.Also known as volatile memory.port for using USB accessoriescamera attached to the monitor.displays the video, image, and text.often called "the brain" of the computer.cord to connect the computer to ethernet....

Metaphors Wordsearch 2025-10-21

12 Items: The test was a ________ - It was easyThey are bookworms - They like __________He is an _______ ______- He wakes up earlyLife is a _________ - Life has ups and downsThe car was a ________ - The car was very fastHis brain is a sponge - He learns things ______She is a ________ - She is steady and dependable...

Parasitism Word Search 2023-03-24

9 Items: Symbiotic relationship in which both organisms benefitThe ____ system allows you to respond to your environment.The _____ system is responsible for making your body move.The _____ endocrine system regulates your body with different hormones.Symbiotic relationship in which one organism benefits, and the other is harmed...

Vegetables and Fruits 2024-12-31

9 Items: What is the hydrating fruit that is 92% water?Which berry is known for improving memory and brain health?What fruit contains an enzyme called bromelain that aids digestion?What cruciferous vegetable is known for its detoxifying properties?Which leafy green is packed with vitamin K and helps in blood clotting?...

Cannabis Use Disorder 2025-03-17

10 Items: Most likely to develop CUDBrain receptors that interact with cannabis compounds.The need to use more cannabis to achieve the same effects.The main psychoactive component in cannabis responsible for its effects.A condition causing severe nausea and vomiting due to chronic cannabis use....

Respiratory System 2022-09-12

28 Items: chestblood clotsuffocatingtaking in of airnormal breathingvocal apparatus of larynxanother name for windpipeinflammation of the lungsinflammation of the larynxair or gas in chest cavityplastic surgery on the nosemembrane surrounding each lungtemporary absence of breathinganother name for auditory tubelabored or difficulty breathing...

March 2024 Ambassador Word Search 2024-03-11

20 Items: Basic unit of digital informationProgramming instructions for softwarePattern recognition through algorithmsAdvanced neural network-based learningProcess of acquiring knowledge or skillsExtraction of insights from large datasetsA specific job or assignment to be completedField involving automated machines and systems...

Science 2025-07-21

20 Items: poisonousbiological catalystpH <7; turns litmus reddisease causing microbepolymer made up of amino acidsone of the 5 Kingdoms, think mushroomoccurs in chlorophyll, plants do thisa place where there is no matter at allhaploid cell used for sexual reproductionsolution that has passed through a filterforce of attraction between atoms or ions...

Anatomy & Physiology-Bones (Milady Esthetics) 2024-06-04

30 Items: aka digitsback of the neckbone forming the foreheadbones that form upper jawforms sides of eye socketform the bridge of the noseform the sides and top of craniumconnection between 2 or more bonesoval, bony case that protects the brain12 pairs of bones forming wall of thoraxaka collarbone; joins sternum and scapula...

Spring into Security 2024 Word Search 2024-02-14

20 Items: Basic unit of digital information.Programming instructions for software.Pattern recognition through algorithms.Advanced neural network-based learning.Process of acquiring knowledge or skills.Extraction of insights from large datasets.A specific job or assignment to be completed.Field involving automated machines and systems....

States of Consciousness 2025-09-29

17 Items: short daytime restlightest stage of sleepthing you lay your head on at nightstate of rest where the body recovershow sleep disorders are often diagnosedmeasured by EEG, slows as sleep progresseschemical in the brain that makes you sleepycondition where you can't fall asleep easilynatural daily pattern of sleep and wakefulness...

Choice Word Search 2024-11-11

19 Items: an apartment buildinghow heavy something isstories, poems and playsdepartment that sells productspersuade someone to by somethingunit of measuring liquid in Europeopportunity to decide between optionsowned/ used by someone else before meworried that something bad will happenunit of measuring liquid in the UK and US...

Recap Unit 9 2024-11-11

19 Items: an apartment buildinghow heavy something isstories, poems and playsdepartment that sells productspersuade someone to by somethingunit of measuring liquid in Europeopportunity to decide between optionsowned/ used by someone else before meworried that something bad will happenunit of measuring liquid in the UK and US...

Parts of the Computer 2024-11-05

9 Items: This is the brain of the computerThis is a camera for the computerThe part of the computer that has the screenAn input device that allows you to select things on the screen.It is an input device that allows you to write letters and numbersAllows a group of people to hear the sound coming from the computer...

Structures and Functions of Animals 2023-12-13

10 Items: Animals eat other __________ to get energy.A _________ is where an animal makes its home.Traveling in herds is a type of _____________ adaptation.Fish use ______ to exchange gases with the water that surrounds them.The ability to run fast is an example of a ______________ adaptation....

Skylar P. Halloween Crossword Puzzle 2024-10-31

15 Items: The season after springWhat protects your brainCommonly worn at a masquerade partyThe creation of spider to catch foodAll that we have left after a body rotsUsually seen with a broom and a cauldronThis is usually associated with werewolfsThe place where dead loved ones are buriedThe day after all Hallow's Eve in Catholicism...

Brain Word Search 2025-02-25

1 Item: Impulsivity

Epithelial Word Search 2025-11-20

18 Items: Neurontissue.SecretionAbsorptionMatrix(ECM)stomach lining.around bone cells.leaving the bladder.secretes digestive juices.in absorption, secretion, and sensation.release of useful substances produced by cells or glands.of tissue that covers body surfaces, lines organs, and forms protective barriers; also...

Computer Hardware Vocabulary 2024-10-28

11 Items: Provides electrical power to the components in the computer.A dedicated card for handling graphics rendering and processing.A standard interface used for connecting external devices to a computer.A wireless technology used for short-range communication between devices.The main circuit board that connects and holds various hardware components....

Semester Review 2025-05-20

28 Items: kneecapFormation of bone"Good" cholesterolOnly moveable skull boneDeep grooves in the brainMain site of gas exchangeGland that secretes earwaxTerm for too little oxygenA part of the thoracic cageLiquid element of the bloodNormal range is 70-15 mg/dLRupturing of red blood cellsUpper portion of the sternumkeeps food out of the trachea...

Organs of the body 2023-01-20

1 Item: lungs,kidneys,large intestine, spleen, liver, stomach, brain, bladder, skin, small intestine

Milady Anatomy & Physiology : Glands 2023-06-21

11 Items: Most complex organ of the endocrine systemPlays a major role in sexual development, sleep, and metabolismFunction in sexual reproduction as well as determining male and female characteristicsFunction in sexual reproduction as well as determining male and female characteristics...

G8 - Cells & Systems Vocab. 2022-11-14

38 Items: what something doesthe brain of the cellhow something is shapedmade up of only one cellstores water in the cellmade up of more than one cellan organ system that creates lifethere are 4 of these in your heartan organ system that helps you moveAll cells come from __________ cellskeeping a body's internal conditions stable...

D&S WORD SEARCH 2023-03-07

25 Items: Brachialan artificial limbopposite of flexioncrippling arthritismedical term for fartfree from contaminationverbal threat to cause harma microbe that causes diseasethe side not affected by strokeviolence that occurs in the homeosteo is one form of this diseasea brain disorder that causes seizuresthis health care provides comfort care...

MODULE 1C: WORD SEARCH 2025-03-15

15 Items: movement of water through a membrane.Plant hormones that help with growth.A chemical that controls body functions.A nerve cell that sends messages in the body.The long part of a neuron that carries signals.System The system in the body that makes hormones.The tiny gap where nerve signals pass between neurons....

Nervous System Trauma & Presentation and Assessment of Spinal Cord Injuries 2025-11-10

15 Items: Approach to managing trauma (initials)Assess patient's level of this using GCSTemporary loss of function in nerve conductionFirst priority once the patient has been assessedSymptom can be experienced as numbness or tinglingSymptom that can present as reduced muscle strengthImpact on the bladder once voluntary control is lost...

jeffery dahmer word search 2024-12-15

10 Items: Milwaukee: where most of his killings wereSkulls: one of the many forms of souvenirs he keptLobotomy: performed on victims to make them "zombie-like"Photographs: he would take pictures of his victims as a mementoSouvenirs: he often kept body parts and other mementos of his victims...

Organs so scary yet so cool! 2024-07-19

11 Items: Organ storing urine before it is excreted from the body.Digestive organ where food is broken down and mixed with digestive enzymes.Pair of organs involved in respiration, exchanging oxygen and carbon dioxide.Long, coiled organs where nutrients and water are absorbed from digested food....

Chapter 3 the biology of psychoactive substances 2025-09-12

11 Items: Fetal _______ spectrum disorder.______ use is a confounding element of drug research.______ explains past events and predicts feature events._______ doubles, the likelihood of sudden infinite death syndrome.________ drugs mimic neurotransmitters, and attached to receptor sites...

Carotid Word Search 2025-11-20

12 Items: sweating excessivelyawareness and response, awakeCardiopulmonary Resuscitationblue skin discoloration resulting from decreased oxygena device that can deliver electrical current to the heart,: any person between the age of one year and before pubertyadministering an electrical shock to the heart to restore heartbeat...

MK-Ultra Overview 2025-02-10

1 Item: drug, mind control, ideology, perception, brain, propaganda, government, technology, torture, secret, cia, abuse, project, computer

Bill Nye Music Word Search 2025-10-20

20 Items: A single sound or tone in music.How many sound waves pass by each second.How high or low a sound seems to our ears.The pattern of beats that makes music move.The unit used to measure how loud sound is.A set of notes that go up or down in order.The gas around us that sound travels through.The way sound travels outward from its source....

Week 20 Thursday 2024-02-11

25 Items: adultsthoughtto knowunable to speakto previously fightable to do somethinghaving the same valuemaking a lot of noisepertaining to the brainimpulsive and unpredictableA break in the earth's crustto get or gain through some effortto think that something will happena piece of land surrounded by waterwilling to wait without complaining...

Unit 3 Spelling Word Search 2023-02-21

1 Item: shock, sloth, thought, where, which, stray, plain, brain, weight, neighbor, great, break, eagle, breathe, believe, freeze

x 2023-02-03

191 Items: menasddsmmomdadsonhugpopseesawyouonetwokinnewoldfunaceawekeylabpepskyvexwaywhywhowrytoyslyspyorbactadohexeastwestalpsmaleboysadhdpureshutmemegoodfineauntcarenicekindloveaxispingpeekpokefeelfeltfaceseekwisegemsgoalminemindmorejustkindsingplaygamebossusedfreefunkheadopenwhennorthsouthbraingirlswomenloyaleagertruthplainquickshortreadyalertrulesblush...

Week 19 Thursday 2024-02-11

25 Items: adultsthoughtto knowunable to speakto previously fightable to do somethinghaving the same valuemaking a lot of noisepertaining to the brainimpulsive and unpredictableA break in the earth's crustto get or gain through some effortto think that something will happena piece of land surrounded by waterwilling to wait without complaining...