books Word Searches

Global II Review 2024-06-03

24 Items: "Gold, God, and Glory"Louis XIV's fancy house.Seafaring Scandinavian warriorsThe capital of the Byzantine Empire,The head of the Roman Catholic Church.Famous Empress of the Byzantine Empire.Probably the most famous German monk ever.The 1054 split within the Christian Church.A major Mesoamerican capital built on Lake Texcoco....

All About 3rd Grade! 2022-06-08

1 Item: Chapter books, Animal Research, Poems, Opinion Writing, Jump Rope, Multiplication, Division, Clocks, Fractions, Area, Perimeter, Geometry, Invertebrates, Vertebrates, Photosynthesis, Mystery Science, Life Cycles, Weather, Pilgrims, American Revolution, Ma

Linguistics 2024-2025 2025-06-06

1 Item: cologne, cats, Pumpkin, laughing, rgrdotfun, dairy queen, hedgehogs, donuts, giggles, quinceanera, LawandOrder, football, basketball, wrestling, ElSalvador, stealing books, where's Gianni, braids, gymnastics, cheer, proposals, Archie, track, mountain, who

Digital Literacy 2026-03-16

15 Items: Also called programs, use the platform to perform tasks.Equal to 1,024 GB, approximately equal to trillion bytes.A sequence of instructions that can be executed by a computer.A pattern or picture on the screen background that you can choose.The plural for the Latin word datum, meaning an item of information....

Cat Word Search 2024-01-04

10 Items: Counted among the most dangerous of all animals (Isaiah 11:8)The practice of this is condemned in the Bible (Deuteronomy 18:10)Malchus lost one when Peter struck him with his sword (John 18:10)The greatest one of all human history takes place at Har–Magedon (Revelation 16:14, 16)...

90 ~ ALL ABOUT BARBARA ~ 90 2025-01-10

1 Item: Alexander Amber Atlast ATJohnson AZavier Barbara Baseball birds Bloomington blueberries Bobbie Bogota books clamchowder colorfulflowers Colin Cooke crabcakes creamedspinach Doris earrings education Ellen elephants Europe Farm fishroe Gaithers garden games

Marbles Word Search 2025-09-22

1 Item: beach pokemon quarters staples books bank money cheeseburger torta tacos bills appointment checkbook statement utility plant math variable payment candy luxury tiktok instagram facebook tape colors marker notes phone

Spring 2026 - Unit II & III 2026-04-21

25 Items: Muslim empire that ruled much of IndiaMachine that allowed books to be mass producedArt technique that creates the illusion of depthA revolt that helped overthrow Mongol rule in ChinaPalace complex in Beijing where Ming emperors livedPayments made to the Church for forgiveness of sinsEmpires that used gunpowder weapons to expand power...

One Word Search 2024-10-06

250 Items: eggpanwaxboxsipsixflyskicubkeynewpopnodcardadyarnpinewoolharmkneewrenzoombuzzlewdmilkblowpinklovetrayslimfilmdimestemsailwoodlookantsrailclambabychopedgenosyneststopfoldwailshutlickusednameteamruinpasthalfmeltsucksighcoalcornnicetablebrassjollyflakyflashstarthauntquilttrampsmashcrimeerectdrinkbikescolorjumpymilkyclothducksspicywearycruelquicktense...

Activities Word Search 2026-03-12

250 Items: ARTBEDBIBCUPMOPMOMMUGNAPZOOBABYBATHBIKECAKEEGGSFOODGLUEHATSHOMEHUGSKIDSMEALMESSMILKOVENPARKRESTSANDSOAPTIDYTOYSTRIPWALKYARDAPPLEAPRONBOOKSBROOMCLOCKCOATSDRYERFLOORFRUITJUICELUNCHMEALSPAINTPAPERPIZZAPOTTYSHOESSLEEPSNACKSOCKSSPILLSPOONSTAINSTORYSTOVESTUDYSWINGTABLETEDDYTRASHWATERWIPESBAKINGBANANABLOCKSBOTTLEBUCKETCARPETCEREALCHORESCLOSETCRAFTSDINNER...

90 ~ ALL ABOUT BARBARA ~ 90 2025-01-10

1 Item: Alexander Amber Atlast ATJohnson AZavier Barbara Baseball birds Bloomington blueberries Bobbie Bogota books clamchowder colorfulflowers Colin Cooke crabcakes creamedspinach Doris earrings education Ellen elephants Europe Farm fishroe Gaithers garden games

WORD SEARCH (KIDS) 2025-01-25

20 Items: One of Nabi Muhammad’s sons.There are ____ pillars in Islam.The belief that there is only one God.The ninth month of the Islamic calendar.The place where Masjid an-Nabawi located.The full name of Nabi Muhammad’s first wife.The sura we are encouraged to read every Friday.The name of the month Nabi Muhammad was born in....

Vgvgvgv 2026-03-13

250 Items: CATJAMMUGNAPPIETEACAKEHUGSLAMPLOVEOVENSOFASOUPWALKYARDAPRONATTICBOOKSCANDYCHAIRCHESSCHINACLOCKCOCOACOUCHDOILYFENCEHONEYJELLYPIANOPORCHQUILTSTOVESUGARTABLEBAKINGBASKETBUTTERCARPETCOFFEECRAFTSDINNERDRAWERFAMILYFRIDGEGARDENPANTRYPILLOWRECIPESCONESSEWINGSUNTEATHREADTREATSWARMTHWINDOWBLANKETBUTTONSCANNINGCOBBLERCOOKIESCOOKINGCOUNTERCROCHETDOORMATDRAWING...

90 ~ ALL ABOUT BARBARA ~ 90 2025-01-10

1 Item: Alexander Amber Atlast ATJohnson AZavier Barbara Baseball birds Bloomington blueberries Bobbie Bogota books clamchowder colorfulflowers Colin Cooke crabcakes creamedspinach Doris earrings education Ellen elephants Europe Farm fishroe Gaithers garden games

The Books of the New Testament 2023-08-02

1 Item: seven, gospels, epistles, apocalypse, canon, apostles, inspiration, letters, church, acts, epistles, deacon, romans, Corinthians, Galatians, Ephesians, Philippians, Colossians, Timothy, Titus, Philemon, Hebrews, James, Peter, John, Jude, revelation

Abrir Word Search 2023-04-27

26 Items: What you do to a boxwhat you do on a bikea pet related to a wolfTo actively do a sport .How you refer to yourselfin a small amount of time.how you refer to someone elseHow you refer to multiple peopleA place where you can rent books.to contact somebody on a telephoneto lift something up and to move itHow you refer to a female object or somebody,...

Abrir Word Search 2023-04-27

26 Items: What you do to a boxwhat you do on a bikea pet related to a wolfTo actively do a sport .How you refer to yourselfin a small amount of time.how you refer to someone elseHow you refer to multiple peopleA place where you can rent books.to contact somebody on a telephoneto lift something up and to move itHOw you refer to a female object or somebody,...

Find 3 Things You're Grateful For... 2022-11-23

1 Item: gravy, pie, sky, sun, family, air, dogs, cats, hamsters, trees, flowers, kids, friends, love, peace, books, breath, space, water, kindness, hugs, blankets, pillows, birds, string lights, laughter, music, incense, chocolate, ham, salad, cheese, cookies, ca

norse mythology 2023-01-18

15 Items: Many slain in battle will end up here.The Nine Realms all cling to this ash tree.The day Tuesday is named after this Norse God.After the Ragnarok cataclysm, these two re-populated the world.This monstrous wolf and problem for the gods is somehow Loki's offspring.We know so much about Norse Mythology because of the writings of this man....

norse mythology 2023-01-18

15 Items: Many slain in battle will end up here.The Nine Realms all cling to this ash tree.The day Tuesday is named after this Norse God.After the Ragnarok cataclysm, these two re-populated the world.This monstrous wolf and problem for the gods is somehow Loki's offspring.We know so much about Norse Mythology because of the writings of this man....

EXERCISE 130326 2026-03-13

30 Items: Differences that weaken an analogy argumentAn error in reasoning that weakens an argumentUsing someone else's work without proper creditKey factors that strengthen arguments by analogyThe main argument or claim presented in an essayEvaluating the author's expertise or credentialsRestating an author’s ideas using your own words...

3B 0726 2022-07-23

25 Items: unwisegreatly surpriseda very large expanse of seafeeling or showing surprisehighly pleasant to the tasteknown and recognized by many peoplea piece of land surrounded by waterfeeling fear or anxiety; frightenedcome or go back to a place or personcoming before all others in time or orderpursue in order to catch or catch up with...

Let's review verbs in the simple past tense! 2023-07-03

26 Items: Ana _____ (sleep) early on his vacation.Camila _____ (have) so much fun last summer!Alejandro____ (do) his their homework last week.Esmeralda ___(go) to the supermarket last weekend.My students ___ (forget) their homework last week.Randall ______ (watch) movies on Netflix yesterday.My mom _____ (find) the money I lost on the street....

Escape Room 2025-07-31

5 Items: When darkness falls and shadows creep, I help brave heroes take a peep. I shine a beam both strong and bright, What am I? I’m a _________!A magician waves a wand with flair, Hides a secret right in the air. With a puff and a swirl, you can’t believe— Watch closely now, as they ______!...

TechnoTangle 2025-09-22

18 Items: I’m the memory that sips power like tea but runs like a sprinter—guess my name!He balances the books and the future—Dublin roots, Silicon Valley fruits. Who is he?I don’t guess—I prove! I’m the logic lawyer who makes your design airtight. Who am I?I mix virtual dreams with real machines—your system’s simulation playground. Who am I?...

ntro to Arts A/V Tech and Comm Weeks 13 - 14 2025-12-03

24 Items: A unit used to measure the intensity of sound.The art and technique of motion-picture photography.The written text for a play, film, or broadcast production.A public display of art, objects, or information for viewing.The process of repeating a segment of audio or video in production....

4B 0609 2023-06-08

20 Items: In Taiwan, people use LINE to ______ with each other.There was an ______ in the building, call 119 for help !There are two ______ routes you can take to the library.Police believed the ______ got in through the kitchen window.The ________ walk around on the floor looking for food that people dropped....

Spelling 2024-05-27

15 Items: The day after today. It's like yesterday, but coming in the future!This is grown-up stuff like offices and stores. It's where people work to earn money.When you wish you had something someone else has, like a new toy or a friend's special skill.Feeling shy or uncomfortable because you did something silly or someone pointed out a mistake....

Unit 2 2025-12-23

51 Items: (n) a thingvery or a lotliving, not deadbut, even thougha trip in a planefind something newwhat you talk aboutno sound; very quietbefore; up to a timethe planet we live onsomething that happensasleep to start sleepingbeing safe, not in dangerhappening now, right awaylike to seem like somethingwhen two people get married(somebody) know tell someone...

Islamic Art Chapter 13 2026-01-15

40 Items: In what city was Muhammad born?What Arabic word means “the God”?What are followers of Islam called?What is the holy book of Islam called?What tall tower is attached to a mosque?What is a Muslim place of worship called?What term refers to a sacred religious text?Another name for the Koran is the __________....

Memoir Unit - Holocaust LIt 2025-10-09

20 Items: To give a false representation ofa state that is controlled and protected by another(of a person) not recognized as a citizen of any countryAn organized, state-sponsored attack on a group of peopleA person who carries out a harmful, illegal, or immoral act.To surrender often after negotiation of terms, to cease resisting...

Nonfiction Memoir VST 2025-10-09

20 Items: To give a false representation ofa state that is controlled and protected by another.(of a person) not recognized as a citizen of any country.An organized, state-sponsored attack on a group of people.a person who carries out a harmful, illegal, or immoral act.To surrender often after negotiation of terms, to cease resisting...

Ladies' Birthday Word Search 2026-01-12

54 Items: The end in GermanOma’s hometown in GermanyThe fatal blow to the DaytonaIssa’s automatic comfort foodPlace where you first met IssaSnack Katie says makes Issa happySimple soup the kids always cravedWord Katie most associates with MomPlace Katie says Issa goes to relaxWhat feels uniquely yours with IssaSomething that defined life with Mom...

Feverishly Word Search 2023-11-16

43 Items: a pouting expressioncontinues to exist; lastsgreatly astonished or amazedpursue or approach stealthilylasting only for a short timein a strange and frightening mannerbitterly disappointing or upsettingcapable of being precisely identifieddeep respect for someone or somethingin a frantically excited or energetic manner...

☆Echo Word Search!☆ 2024-04-22

30 Items: The scientific study of insects.The scientific study of language.The art of thinking. Translated from Greek into "the love for wisdom".French composer and pianist, known for his Gymnopédies and Gnossiennes.Fictional band, created by Blur frontman Damon Albarn and artist Jamie Hewlett....

1 Word Search 2026-01-20

42 Items: 23LAUREN: Ian! Ian! I have an idea!LAUREN: I told you! You were a great success![Lauren watches as Ian slouches onto his bed.]IAN: You have yourself a deal. Winner takes all![Lauren and Ian wait backstage at the talent show.]MOTHER: Ian, you’re running late. It’s time for breakfast!LAUREN: Do-re-mi-fa-sol-la-ti-do. DO-RE-MI-FA-SOL-LA-TI-DOOO....