biology Word Searches

Evolution Word Search 2026-04-13

10 Items: characters: newly evolved traits that differ from the ancestral formworld hypothesis: early life forms relied solely on self-replicating RNAprocesses: that lead to the formation of species found in one specific geographical areaselection: intentional breeding of plants or animals by humans to promote desirable traits...

Unit 3 Words 2026-01-04

1 Item: go online, teenager campus, department, directions, fountain, location, monument, rainfall, season, Biology, Business, Geography, Literature, Management, Physics, timetable, weekdays, weekend

Biology Revision - Year 8 2025-06-12

1 Item: aerobic, anaerobic, mitochondria, nucleus, skeleton, ligament, tendon, bone, antagonistic, muscle, cartilage, alveolus, lung, diaphragm, lacticacid, redbloodcell, heart, ventricle, atrium, artery, capillary,

united 2024-01-05

14 Items: mooncloudserosionatmosphereDwarf planet with two moonsplanet with the biggest ringslargest planet in the solar systemhottest planet in the solar systembranch of biology that deal with the study of plants, including their structure, properties, and biochemical processes....

Lombroso’s Atavistic Form theory – wordsearch 2026-01-07

14 Items: Relating to the measurement of human physical characteristics.Based on direct observation or measurement, rather than opinion.A discredited early approach linking skull shape to personality and behaviour.A research method involving watching and recording behaviour or characteristics....

Science: Word Search 2024-08-18

19 Items: Living planetThe study of lifesignal to which an organism respondsthe variable that is deliberately changed.A single organism produces offspring identical to itself.all other variables should be kept unchanged, or controlled.logical interpretation based on what scientists already know....

Breakthrough Inventions and Innovations 2025-04-14

10 Items: MICROSCOPE : An instrument used to view objects too small for the naked eye.3DPRINTER : A machine that creates three-dimensional objects by adding material layer by layer.FUSION : The process of combining two atoms to form a heavier atom, releasing vast amounts of energy....

Evolution Word Search 2022-08-24

15 Items: A segment of DNA that codes for one specific protein.Changes within a population over long periods of time.A visible characteristic due to an individual's genotype.The passing down of genes from one generation to the next.An evolutionary force due to mate selection and preference.A genotype where both alleles of a given gene are the same....

Happy Pharmacy Week 2025-10-09

1 Item: Tech, Buyer, Prescription, Medication, Biology, Capsule, Injection, Tablet, Chemistry, Dose, Interactions, Effects, Adverse, Pharmaceutics, Potassium, Vancomycin, Famotidine, Diltiazem, Ativan, Morphine, Prozac, Celecoxib, Albuterol, Zolpidem, Ibuprofen,

Prefix Suffix Root Word Search 2023-09-04

28 Items: suffix meaning without3 letter prefix meaning middleprefix that means too much or aboveword part meaning study of; biologyprefix meaning not; used in nonsensesuffix meaning made of; used in woodenprefix meaning not; used in impossibleprefix meaning not; used in inattentiveprefix meaning not; used in uninterested...

Unit 4: Spelling Quiz 1 2022-11-29

30 Items: comicaltruthfulnessshowing mercymarking a distinctiona physical disabilitydefiance of authoritythe operation of aircraftto set or keep apart; dividenasty or disgusting in naturean overseer or head of a groupto grasp suddenly and forciblyof a particular person; privatethe pouch which encases a letterthe biological science of animals...

Prefix Suffix Root 2023-09-04

28 Items: suffix meaning without3 letter prefix meaning middleprefix that means too much or aboveprefix meaning not; used in nonsensesuffix meaning made of; used in woodenprefix meaning not; used in impossibleprefix meaning not; used in inattentiveprefix meaning not; used in uninterestedword part meaning water; used in hydrant...

VOCABULARY STAGE 3 2025-10-03

1 Item: Biology Literature Chemistry Poetry University amazing degree languages course exchange match game championship race singer artirst journalist musician photographer actor designer police officer firefighter pilot highway railroad luggage passengers goods

Academic Word Search 2026-03-08

250 Items: ARTBUSFUNLABTAGBANDBELLBOOKCLUBDATADESKDOOREXAMGLUEHALLIDEALOCKNOTEPLAYQUIZRICETEAMATLASCARDSCHAIRCHESSCLASSDRAMAESSAYFOCUSGAMESGOALSGROUPMEDALMUSICRULESSLIDESTAGESTUDYTRACKTUTORBINDERBURGERCODINGDEBATEEFFORTERASERFRUITSHEALTHLAPTOPLOCKERMARKERNAPKINOFFICEPENCILRECESSREVIEWSAFETYSOCCERSPORTSSTAIRSTABLETTROPHYVIOLINWARMUPADVISORALGEBRAARTROOMBIOLOGY...

School 2026-02-11

250 Items: GymPenClubDeskExamQuizRuleTestWiFiBreakChairClassCoachEmailEssayGradeLunchNotesNursePaperStaffTutorVideoAgendaBinderCampusCourseDebateFolderLaptopLessonLockerMarkerMentorOfficeParentPencilRecessReportReviewRewardSafetySchoolSeniorSpeechSportsSurveyUpdateAbsenceAlgebraArtRoomBiologyCollegeDiplomaEnglishFacultyHistoryJanitorJournalLibraryMeeting...

Invertebrate word search - Zoology Project 2025-12-13

35 Items: No symmetrythe flatwormsToward the topthe roundwormstwo equal sidesToward the backToward the backToward the sideCircular patternToward the frontToward the bellyToward the bottomToward the midlinethe segmented wormsthat create silk for websFormerly known as arachnidsmeans “spiny skin” in latinmeans “jointed foot” in Greek...

Scientific Revolution and Enlightenment 2026-01-06

26 Items: The study of light.The study of living organisms.Newton’s explanation of gravity.Proposed the heliocentric theory.Rules explaining how objects move.The study of matter and its properties.Tool used to observe very small objects.Tool used to observe distant objects in space.Promoted empiricism and evidence-based science....

Anatomy 2025-12-03

30 Items: Lying face up.Deoxyribonucleic acidThe inside of the bodyThe front of the body.The outer layer of the skin.Movement towards the midline.The scientific study of life.The middle layer of the skin.The largest organ of the body.Movement away from the midline.Turning a body part down or backward.Indicates a location closer to the head...

CVA Review Game 2024-01-05

16 Items: Pertaining to the heartAnything that makes a substance unusable for its intended purpose.Section Delivery of fetus by incision through the abdominal wall and uterine wall.Pertaining to the cranium or the head end of the body, or anterior end of the body.A light proof housing for X-ray film, containing front and back intensifying screens....

Breed Word Search 2024-01-05

16 Items: Pertaining to the heartAnything that makes a substance unusable for its intended purpose.Section Delivery of fetus by incision through the abdominal wall and uterine wall.Pertaining to the cranium or the head end of the body, or anterior end of the body.A light proof housing for X-ray film, containing front and back intensifying screens....

Foucault Activity 2025-11-21

17 Items: the presumption that heterosexuality is normalthe institutional use of bodies purposes of controlcategorizations, talk, and silences pertaining to social practicesthe code or meanings inscribed in language and other symbols in a given societal contextthe idea that homosexuality and what it means to be gay vary across history and social context...

Microbial Growth 2024-10-14

32 Items: Often used as an indicator of microbial growth.Nutrients required by organisms in small amounts.Nutrients required by organisms in large amounts.An organism that thrives at very low temperatures.Long-term interaction between two different species.Organisms that require oxygen for survival and growth....

Extra Credit Word-of-the-Day Search 2026-02-20

42 Items: enormousoffense or annoyanceloud and harsh; gratingnot harmful or offensivemisty, dim; obscure, darkambush (someone); an ambushextremely stupid or foolishexpress contempt for; ridiculenoisy and difficult to controlTo argue about petty things; to squabbleTo mix up, confuse, bamboozle, or jumbleprovide money to pay (a cost or expense)...

A- Word Search 2023-01-25

26 Items: Kinetic Engineer: A kinetic engineer is an engineer that emphasizes on heat and mass transfer and deals with the process of design.Utility Engineer: A utility engineer is a civil engineer who works for a utility company, such as a water, gas, or electric company....

Engineers A to Z 2023-01-24

26 Items: Investigate force and motion by working in teams to complete design challenges and build ramps and pathways!Introduction. Genetic engineers alter, splice, eliminate, and rearrange genes in order to modify an organism or groups of organisms....