atoms and molecules Word Searches

Chemistry, Physics, and Energy 2023-05-14

20 Items: measured in Newtonsmeasured in mL or cm^3they make up the periodic tablemetals are good examples of thesethe first step in the water cyclethe formula for it is mass/volumeplastics are good examples of thesethe formula for it is distance/timea phase change, the opposite of depositionthere are two types of it-positive and negative...

max and the midknights book 1 and 2 2021-12-21

66 Items: maxsirbeelutenatebookwandcopycragkingmaryknotpearsimongoosenolanbrucekevynsworddustytorinborisrovakseedsdwarfconradmilliedragonbananapeircewrightfendradaggerbladessheildbananaguardsbodkinseymortomatoportalpotionbudrickmumblinbyjoviaghastlylincolncrossedcrystalnereliavulturegriffingadaboutsedgwickbrickbatknotheadleafnadobagpipesformlingsdogmother...

LONG e and LONG i (ee and igh) 2024-03-08

21 Items: seemeetfreeneedsighteenkeeppeepnightthreelightrightgreensleeptightmightteethstreetflightspeechplight

Prefixes and suffixes from week 5 and 6 2025-11-11

25 Items: denydecayreplyrewardreportdecidereturndefendreportrepairdefeatdemanddepartuselessreplacerecyclerewritedelightdefrostgoodnessharmlessprincesscarelesspainlesshopeless

Short o and long o (CVCe and CVVC) 2025-11-11

21 Items: lostroadboatlovegoatsoapfoamloadnonesofttoadcoatdrovechoseknockslopewholetoastfloatcrossstone

Baby Items 2024-06-11

24 Items: bagmatseatcribtoysclothtablewipesbottlemobileonesierattlediapersformulamonitorblanketbassinetclipperspacifierand Playstrollerhighchairnightlightthermometer

ENGLISH SPEAKING COUNTRIES 2025-03-21

29 Items: MALTAGHANAKENYAINDIASTATESCANADAGUYANAGAMBIARWANDAAFRICAKINGDOMIRELANDBAHAMASJAMAICANAMIBIANIGERIAISLANDSZEALANDVANUATUBOTSWANACAMEROONZIMBABWEPAKISTANKIRIBATISINGAPOREAUSTRALIAAND TOBAGOMICRONESIAPHILIPPINES

ROMANS 5; 21 2025-04-25

34 Items: SOASTOUSINSINALLANDNOWGODOURJUSTOVERTHEMGODSWITHLIFELORDRULEDDEATHGRACERULESRIGHTJESUSPEOPLEGIVINGCHRISTBROUGHTINSTEADETERNALTHROUGHSTANDINGWONDERFULRESULTING

Agri 1 Formative assessment 2 2025-08-19

30 Items: BudMossBulbCormScionUnionCleftWedgeTuberSpliceStolonHormoneRhizomeBuddingBuddingBuddingGraftingApproachLayeringLayeringLayeringLayeringStoolingDivisionBudStickTbuddingRootstockand TongueSeparationPropagation

Lockehart Word Search 2025-09-30

30 Items: eyesSnowFilmmeatBoneDateBloodSmileVomitCandlemarketMurderCorpseMorgueZombieKnivesCoffinWebcamForestSatanicMaggotsTortureTrinketsReligionStalkingCemeteryFingernailsDecapitationand enteringDismemberment

property and casualty insurance 2025-08-19

18 Items: credit reporting act(federal regulation)event - $ 200 millionoriginally enacted in 2002result of 9/11 attacks on U.Sup to 10 years in prison or bothinsurers and producers must complypenalty - $ 5,000 1 year in prison or bothis illegal to make false statements if guiltystategramm - leach bliley act (is USC section 206)...

Science Vocabulary 2023-03-28

20 Items: DNA has a double _______ shape.A cell without a nucleus. _____________________The powerhouse of the cell. _____________________The control center of the cell. _____________________Charles __________ is known as the Father of Evolution.In _____________________, DNA is converted to an RNA code....

Our Word Search 2025-01-26

20 Items: your halloween costumeOur first winter vacationWhat I said on January 4thThe nickname I use for youThe most handsome boy everThe name of our newest playlistWe are each our favorite at this activityThe song we recently learned was about WLWThis is embroidered on your hat I made youWe went skinny dipping at this hot springs...

Magazine 3 2025-08-19

24 Items: a small songbirda body of running waterthin; having little widtha pleasant smell; fragrancea stopper for a bottle or jugto be unwilling to do somethingsomething that is made or growngiving it strength so it can lastto carry from one place to anotherto push or force into a small placea ruler in charge of land and people...

Vocabulary Lesson 6: Connecting 2025-11-07

20 Items: an object that keeps a memory aliveworth being remembered; unforgettableto honor or remember a person or eventto separate from or break ties with somethingrelating to both society and economic factorsnot friendly; does not enjoy being with othersa club or group of people with shared interestspeople living and working together as a community...

How Are New Vaccines/Drugs Developed Word Search 2025-12-03

21 Items: acronym for virus like particlesViruses that infect bacteria are called_______bacteria killing mechanism that involved apoptosis + pyroptosis.a study where participants, researchers, AND data analyzers all don’t knowbacteria killing mechanism including hypoxia tolerance, chemotaxis, motility genes....

Thermal Energy Word Search 2025-10-30

16 Items: the energy an object has because of movingtransfer of energy by electromagnetic wavesthe energy required to change a solid to a liquidthe temperature at which a solid changes to a liquida material through which thermal energy moves slowlyincrease in the volume of a substance when the temperature is increased...

sugar, spice and all things nice! 2024-04-12

8 Items: Foreverbend it likeziga zig ahhhunion jack rulesBiscuit meets spice girlNobody puts _ in the cornercloves, nutmeg, cinnamon and pepperyellow citrus shaped sweet and spicy candy

AR/ER/IR Verbs 2025-11-07

20 Items: I workwe openI shareI studythey runwe shouldwe listenmy mom buysyou all drinkyou all watchJulio and I eatmy parents livethe class learnsthe students attendthe school receivesyou (informal) takeyou (informal) writeyou (informal) believeyou (formal) understandthe students and I read

Spelling 2024-05-27

15 Items: The day after today. It's like yesterday, but coming in the future!This is grown-up stuff like offices and stores. It's where people work to earn money.When you wish you had something someone else has, like a new toy or a friend's special skill.Feeling shy or uncomfortable because you did something silly or someone pointed out a mistake....

Metabolic Acidosis 2025-08-14

6 Items: HemodialysisAntidiarrhealsSodiumbicarbonateCardiacmonitoringPeritonealDialysisfluid and electrolyte balance

Unit 8 2023-11-01

14 Items: thingsnarrow-mindedextremely fat, obesehaving to do with the bodya bad imitation of, a perversion oflacking excitement, ordinary and dullsomething that gets in the way, obstaclea teacher, especially one who is dull andsignificant to one’s own profit or well-beingto bring together features, ideas, or elements...

Decoration 2023-05-15

34 Items: airandcatantarecancareatartendearnotoneranredratteatentietootoerainaeoncardcodeirontoadactorcranedinercreditdancerdoctortornado

Camera Word Search 2024-02-29

30 Items: isorawlenszoomedithourjpegspeedfocusflashmacroframedepthbokehcamerafiltertripodcandidshuttercaptureexposureaperturelightingportraitsnapshotlandscapeof thirdsmegapixelcompositionblack-and-white

Skating Word Search 2024-10-16

30 Items: DoOkAndRungolfNeedTallshowsNoisyBraveRainyDramatennisSkiingHockeyEatingListenSkatingReadingDrawingOlympicskatingOutdoorWritingSwimminghandsomeAthleticsBadmintonEnergeticPhotography

Logika 2024-11-19

34 Items: ornotandtruenulaulazvoćelažnafalsesklopizlazdokazulicaberbalogikaizjavakošarapovrćelogisimsubjektprimjertablicasemaforfunkcijanegacijaistinitajedinicaprovjeravarijablaoperacijaautomobilistinitostkonjunkcijadisjunkcija

May Party Puzzle CHALLENGING!!!! 2025-05-21

35 Items: ANDAKAPOPPERMENUPORKBEERWINESODACHASEFIRSTPARTYSALADPASTASALADCOSTSEIGHTSOCIALTWENTYPULLEDPOTATODRINKSMERELYPERSONDESSERTINCLUDEDOLLARSINCLUDESCOMMITTEEORGANIZEDCLUBHOUSEADMISSIONGREENBRIARTWENTYFIVESANDWICHES

Vocabulary Worksheet 2025-09-23

34 Items: orsosadforandnorbutyethousetakencolorIrenescarffarmscommacocoondetaildesignuniquefanboysimpleclauseobscuremuffledmoldingsubjectspaciousnarratorrecessedcompoundsentencevestibulecaterpillarconjunction

Lockehart Word Search 2025-09-30

30 Items: eyesSnowFilmmeatBoneDateBloodSmileVomitCandlemarketMurderCorpseMorgueZombieKnivesCoffinWebcamForestSatanicMaggotsTortureTrinketsReligionStalkingCemeteryFingernailsDecapitationand enteringDismemberment

Medieval Word Search 2025-11-07

20 Items: LogWineFireFeastHeartCheerShonaBellsCastleCarolsClauseBanquetand IvySolsticeLanternsMistletoeGatheringSnowflakesTapestriesCandlelight

Geology Word Search 2024-12-11

16 Items: Parent RockForm over warm waterFunnel-shaped vortex cloudFast moving volcanic mud flowMakes up most of earth's crustLarge cracks that form in rocksCool, strong outer layer of earthMagma becomes this after eruptionCompass direction of a rock layerOccurs when water dissolves mineralsphysical removal and transport of rocks...

M1 Revision 2023-07-15

15 Items: Games that people try to win.I _______ (100%) brush my teeth.A patio is in your ____________.Free time during the school day.This tells someone where you liveMy favorite ____________ is a guitar.Last year I was a ____ at a dog charity.My friend and I sing in the school ______.Your ____ tells someone where you were born....

Money Word Search 2025-01-16

15 Items: Items that are produced for sale.To set aside money for future use.A plan for managing income and expenses.Money that is owed by one party to another.The money made from business after expenses.The exchange of goods or services for money.Physical money in the form of coins and bills.Money received for work or through investments....

A Monster Calls: Vocab #1 2023-12-04

30 Items: a small sofarefuse to stoplean but strongin an unclear waynecessary for lifeconfused; perplexedto disturb or irritatevery scary or frighteningrise and move, as in wavesa look of anger or dislikea tall tower in a buildinga close friend or associateexpress pleasure with wordsa feeling of a lot of angerexert much effort or energy...

LA stanner 2025-03-12

37 Items: timechangeor bentdisappearenvironmentteam. Proudreluctantlyor intensityinto nothing,”is erratic andcrouched on thesuch a temper is- A showy gesturea grand flourish.- Liable to sudden- Capable of being- To become less in- Become like one's- Go away, scatter,- Shut out from view- Admit or acknowledge, oftenlater, one of the men conceded that...

Unit 3.8 and 3.9 2025-09-08

20 Items: Monetary compensation usually paid hourlyDigital wallet service provided by SamsungMoney sent from one bank account to anotherExample of a digital wallet provided by AppleTraditional in-person learning led by a facilitatorEmployees learn while performing real tasks at workMonetary compensation usually paid monthly or annually...

Joy & Positivity – Fill Your Heart with Light and Happiness 2025-02-01

10 Items: Pure happinessExpecting the bestA state of pure joyRadiating positivityMedicine for the soulFinding joy in the momentHonor every little victoryLight within and around youEmbracing fun and lightnessSeeing the good in everything

Fourth Grade Rules 2024-06-05

5 Items: mathbandrecessscienceand capitals

Spelling/Vocabulary word search puzzle 2022-11-10

15 Items: not alivebring to lifestrong disliking.a small, yellow birdrelating to metaphysics.an animal that feeds on flesh.the form and size of a persons bodythe rebirth of a soul in a new body.a traveling amusement show or circus.a person qualified to practice medicine.relating to the body as opposed to the mind....

Turkey Turkey 2025-11-21

15 Items: The traditional main course.A large and celebratory meal.The time of year when crops are gathered.A festive procession, like the one in NYC.The feeling of appreciation and gratitude.The season when Thanksgiving is celebrated.A group of early settlers who arrived in 1620.The feeling of being thankful and appreciative....

English Law Word Search 2023-09-13

25 Items: Dealt with major civil casesWrote the first Law Code of EnglandA systematic collection of statutes.A written law passed by a legislative bodyA difficult or painful experience, a trialA court of equity, as distinguished from a common-law court.A legal document giving certain rights to a person or company...

Chapter 10 Laboratory Procedures 2024-04-16

14 Items: after eatingaka fasted or before eatingcontains RBCs WBCs and plateletsmultiple samples can be collectedno anticoagulent, blood is clottedserum is cloudy or white, high in fatused for morphology, lavender top tubeused for blood chemistry, green top tubeno anticoagulent, layer to separate serumAKA microhematocrit, percentage RBC in blood...

Word Search 2025-11-06

14 Items: – Appealing; draws people in.– Lived in and active with residents.– Left without upkeep; falling apart.– Dull or ugly; doesn't draw interest.– Old and falling apart; needs fixing.– Updated or restored to look new again.– Full of activity, growth, and success.– Uses resources smartly; works smoothly.– Valuable improvement that benefits many....

Birthday riddle 3 2021-09-06

4 Items: !!andGoodWishes

Independent Living Vocabulary 2024-01-26

15 Items: The longest side of a triangle.The amount of a home that an owner actually owns.The vertical distance between two points on a graph.The horizontal distance between two points on a graph.In a proportion, a/b=c/d , the terms b and c are the meansIn a proportion, a/b=c/d , the terms a and d are the extremes....

Democratic Systems of Government 2025-03-05

10 Items: PartiesDemocracyDemocracyDemocracyDemocracyof PowersElectionsFederalismand BalancesConstitutions

IB History Command Terms 2023-05-02

6 Items: Weigh the limitations and strengthsProvide similarities and differencesConsider the merits of a concept/argumentOffer a balanced range of arguments and/or factorsConsider an argument by uncovering interrelationshipsBreak down in order to bring out elements or structure

Earth and Space Science 2023-03-20

16 Items: a medium-sized star in our solar systemTrue or False-The sun orbits the Earth.the way in which the Earth slants on its axisThis planet is made of gas and has a very long orbit.Earth’s closest star and the center of our Solar SystemThe 4 planets that have long orbits and are made of mostly gas...

Girls only wordsearch 2023-04-24

10 Items: mhmbadandstopwhatbloodrealztiktokthat upso scary

Plagues Over Egypt 2025-10-18

10 Items: FrogsGnatsFliesBoilsLocustsDarknessHail-and-FireDeath-of-LivestockWater-Turned-to-BloodDeath-of-the-Firstborn

Tale Word Search 2023-10-20

10 Items: A group of animalsTo move like a waveAnother word for storyTo push something forwardPast tense of the verb "to hear"To discuss and exchange opinionsA picture made from a group of starsThe time and place where a story happensDone exactly the same way, all the time, ever time.What dogs and cats have (attached to their back or behind)

Descriptive Adjectives 2025-04-14

10 Items: FRAGILE : Easily broken or delicate.VAST : Very large in size or extent.SERENE : Calm, peaceful, and untroubled.VIBRANT : Full of life, energy, and color.GLOWING : Shining with a soft, warm light.GRACEFUL : Moving in an elegant and smooth way.TOWERING : Extremely tall, often impressively so.BRILLIANT : Extremely clever, intelligent, or impressive....

Descriptive Adjectives 2025-04-14

10 Items: FRAGILE : Easily broken or delicate.VAST : Very large in size or extent.SERENE : Calm, peaceful, and untroubled.VIBRANT : Full of life, energy, and color.GLOWING : Shining with a soft, warm light.GRACEFUL : Moving in an elegant and smooth way.TOWERING : Extremely tall, often impressively so.BRILLIANT : Extremely clever, intelligent, or impressive....

Nutrition Word Search 2025-11-24

10 Items: Keeps your body hydratedRed fruit that grows on treesCitrus fruit rich in vitamin CNutrient that gives our body energyMineral that helps build strong bonesCrunchy orange veggie good for our eyesNutrient that helps build and repair our musclesNutrient that is important for brain developmentFood group that includes milk, cheese, and yogurt...

Switching and Routing Terminology 2023-03-29

34 Items: A port that allows traffic from only one VLAN.A logical grouping of computers through segmentation in a LAN.A set of computers and devices connected in one physical location.A naming system that converts human readable domain names into IP addresses.A security feature on some switches that filters out untrusted DHCP messages....

Christmas Gift 2022-12-17

11 Items: 2 10s____ WonderSpeeding ____Yellow brick ____A round____ flightThere's no weird ____ optionDirectors Ethan and ____ CoenYou might get these from shavingThe state of the Boston Tea PartyLando Calrissian actor's first nameEarth, Wind, and Fire remembers this month

Motiondiagram Word Search 2025-09-15

18 Items: Displacementthe sum of two or more vectorsthe difference between two timestotal distance divided by total timeThe length of a path between two pointsGreatness of size, strength, or importanceA quantity that has magnitude and directionA physical quantity that has magnitude only.the location of an object at a particular instant...

CPPI Team Building June 2023 2023-06-27

12 Items: (USDA Innovation Hub)(Diabetes Prevention Program)(One of IPHI’s 3 centers of work)(One of IPHI’s 3 centers of work)(One of IPHI’s 3 centers of work)(Illinois Public Health Institute)(Building Resilient and Inclusive Communities)(State Physical Activity and Nutrition program)(Coalition founded, managed and staffed by IPHI with a new name)...

Turkey Word Search 2025-06-21

10 Items: A big meal with lots of foodA warm sauce poured over foodFeeling happy for what you haveThe people you love and live withWhere everyone sits to eat togetherA soft, yellow bread made with cornWhen fruits and vegetables are pickedA big bird often eaten on ThanksgivingA sweet dessert, often pumpkin or appleBread and herbs cooked inside the turkey

Market Word Search 2025-10-01

20 Items: trustsprofitseffectsmonopolymonopolyfailuresmortgageoligopolycollusionstructure,disclosurecompetitionforeclosurecompetition,competition,price-fixingexternalitiesdiscriminationdifferentiation,and desist order

Constitution Vocab. Word Search 2025-11-04

10 Items: planBranchBranchBranchFederalismCompromiseAmendmentsSovereigntyJersey Planand Balances

Jud and jur and just 2024-10-16

10 Items: JuryJudgeJurorInjuryConjureJudicialJudiciousJudiciaryAdjudicateJurisdiction

Community Helpers 2025-04-14

10 Items: PILOT : A person who flies an airplane.TAILOR : A person who makes or repairs clothes.DENTIST : A person who takes care of people's teeth.TEACHER : A person who helps others learn in schools.GROCER : A person who sells food and other everyday items.FIREFIGHTER : A person who fights fires to keep people safe....

Witch Word Search 2025-10-10

10 Items: Witch hunts began in this continentTime period when people believed in witchesPeople accused of witchcraft often did not follow thisThe religion that spread in Europe and saw magic as evilMagical animals in Japan known for trickery and illusionsFamous event of fear and punishment for witches in America...

First Trimester 2025-09-24

14 Items: chemicals used to dissolve other substancestakes place when a sperm penetrates the egg or ovumwhen the cell inside the zygote splits and replicates itselfalso called a womb; hollow, pear-shaped organ located in the pelvisejection of a mature egg or ovum from the ovary into the fallopian tube...

PCSH Wordsearch Quiz LT2 2023-11-06

10 Items: value of the goodsneeds which are basic to mangoods used to produce other goodsdevice or money used for exchangemost important factor of productionindicator of progress and developmentmay refer to import and export of goodsphysical and mental effort exerted by mana branch dealing with the small parts of the eco...

U1-1 2025-08-02

10 Items: A dried grape.To make liquid fly about in drops.Grown or produced without artificial chemicals.Firm, dry, and easily broken; or, fresh and clean.To scatter small drops or particles over something.To keep something in its original state or in good condition.A meal consisting of several dishes from which guests serve themselves....

Practice Task 2024-10-12

5 Items: The wife of a king or a female monarch.Food made of flour, water, and yeast mixed together and baked.The faculty by which the mind stores, retains, and recalls information.A cold-blooded vertebrate animal that lives in water and has gills and fins.A small, wooden, stringed musical instrument with four strings, played with a bow or by plucking.

Jud and jur and just 2024-10-16

10 Items: JuryJudgeJurorInjuryConjureJudicialJudiciousJudiciaryAdjudicateJurisdiction

Crime, Mum you are playing DETECTIVE! 2025-01-11

9 Items: VeraBrownMarpleFisherPoirotLudwigMurdersIn ParadiseAnd Hathaway

Cultural festivals 2025-11-20

15 Items: DayDayPengFolkNightRaymiRizalNew YearSongkranNew YearNew YearMatarikiPanagbengaThanksgivingand Eid al-Fitr

Income Taxes 2025-01-07

18 Items: UnmarriedMoney that is not taxedEarnings that are taxableSingle but with dependentsMarried and filing togetherSpouse died within the filing yearMarried but filing different tax formsThe line of the tax schedule based on incomeTax that is based on a percentage of the amountThe percentage increases as the amount increases...

Legislative Branch Word Search 2025-02-13

18 Items: What IRS stands forTo lay and collect ________Only Congress can Declare ____What Holiday do we Celebrate on MondayC&B or Power Congress has over SpendingWho decides the Vice President if no one gets 270Right to a fair trial "Show me the Body in Latin"C&B Power Congress has to remove federal officalsWho decides the President if no candidate gets 270...

Fleet Farm Word Search 2025 2025-07-16

18 Items: Where we work.Where our store is located.Each zone has one of these.Hardware will cut this for you.You can get this at our C-Stores.The color most associate us with.We sell these in the Garden Center.Auto has a large selection of this.We have our own brand with Eileen's.Another way we refer to Lawn and Garden....

Unit 2 Review 2023-12-19

10 Items: Push or Pullyour mass plus GravityUnit to measure force(N)How much "stuff" you are made ofsomething you can build with snowForce that pulls things down to eartha tendency to remain unchanged and has a direct relationship with massFor every action (force) in nature there is an equal and opposite reaction....

NHOB 001 2025-01-28

10 Items: THIS PROTECTS YOUR TOES.NOT FULLY SHOOTING A BOLT.TOOL USED TO TEMP A FASTENER.SEATS AND TIRES ARE INSTALLED ON THIS LINE.YELLOW COUPLERS ARE ASSOCIATED WITH THIS SYSTEM.THE ACCESS POINT TO THE REAR CARGO AREA ON THE ACCORDTHESE ARE THE THREE SENSES USED TO CONFIRM SET CONDITION OF A COUPLER....

Do You Get Enough Sleep? 2025-10-10

10 Items: Feeling easily annoyed or grumpyShort moments of forgetting or losing focusRelated to thinking, learning, and understandingThe body's natural defense against germs and sicknessA problem or damage that makes something work less wellThe ability to make smart decisions about right and wrongExtremely important or necessary for life, health, or success...

Eleanor Ch.4 2025-11-11

10 Items: CancelOffical statemantA crop produced mainly for sailA group of people that make lawsOne who opposes official or commonly held veiwsA government in which citizens hold the power to ruleA freedom people possess relating to life, liberty, and propertyA statement or action expressing disapproval of or objection to something...

Memory Word Search (Form A) 2025-05-04

10 Items: Perlexed – confused or puzzledVindicate – to clear someone of blameMeticulous – extremely careful and preciseSuperficial – concerned only with appearancesPrudent – showing good judgment and cautionScrutinize – to examine very closely and carefullyResilient – able to recover quickly from difficulties...

Lion Word Search 2025-09-25

10 Items: It meowsThe king of the jungleThe big animal with trunkAnimal with stripes on its bodyhave wings to fly and beak to singBeautiful insect with colorful wingsLove banana and they say we look alikeIt has two long ears, don't walk but hopsVery tall, the legs can be taller than humanCan swim and have sharp teeth, many people scared of it

2nd Term Vocabularu Review 2024-08-21

16 Items: to shoutopposite of darkopposite of weaksynonym of crazysynonym of troublethe opposite of quicklycloth used on top a bedthe state of feeling illfirmly. Opposite of looselya bird of prey that eats dead animalssocially correct and with good mannerskind, helpful and caring for other peoplesurname of the famous author that we studied this term...

Paragraphs and Essay Writing 2025-11-05

16 Items: finishinga big lettera small letterwhat it is aboutto make a letter bigfirst, _________, third5 paragraph writing assignmentthe world's best baseball teama book with words and synonymsa book with words and definitionsa group of sentences with a related topica phrase that you write at the top centerthere are 26 of these in the English alphabet...

WORDYWORDSEARCH 2025-11-13

9 Items: MANE BIG CATTRUNK GREY HEAVYSMALL SLITHERINGMan's best friendFAT GREY BIG MOUTHSMALL FLUFFY POINTY EARSSTRIPY BLACK AND WHITE HORSESLOW AND STEADY WINS THE RACEROUNDED TAIL CUTE LIKES CARROTS

Monitor Word Search 2025-05-13

9 Items: At what height should a desk be adjusted toWhat items should be placed within arm's reachThis item on a backrest supports the lower backA chair base should have ____ prongs for stabilityApproximately arm's length away and slightly tiltedAdjust chair height until _____ are flat on the floorThis type of break should be taken every 20-30 minutes...

Chapter 6 Vocab Word Search 2022-09-27

15 Items: shows the expected cash outflowsplan for future in quantitative termsexpressing company's goals and objectivescompilation of all budgets/schedules preparedschedule that shows anticipated cash collectionsstandard achieved if operating conditions are perfectdifference between reported budget and realistic budget numbers...

Infection Control Word Search 2024-08-02

15 Items: An example of a fungi is?A living carrier of transmission.Protozoan parasites cause what disease?What is the first step when donning PPE?A vehicle (non-living carrier) of transmission.Airborne precautions are used for which pathogen.A microorganism that causes infection and disease.Contact Plus precautions are used for what Disease?...

Gardening and Plants 2024-09-16

15 Items: A large yellow flower that follows the sun.A miniature tree often grown in small pots.A classic red flower, often symbolizing love.A fragrant purple plant used in aromatherapy.Material spread over soil to retain moisture.A delicate, exotic flower often grown indoors.Decomposed organic matter used to enrich soil....

Technical words - 5 2025-06-20

15 Items: The font style, size, and spacingThe colors chosen for the websiteA layout based on rows and columnsThe overall style and look of a siteThe arrangement of elements on a pageA menu that expands when you hover or clickEmpty space used for readability and designThe service that stores your website onlineLayout that adapts to different screen sizes...

Spelling Words 2.1 2025-11-06

15 Items: very carefulto weep or cryworry or distresspast tense of bringbeing strong and thicka light bluish green colorthe lowest load-bearing part of a buildinga disgusting smell or taste; unpleasantly soiledpour a liquid over; drench; to extinguish a fireto raise something by means of ropes and pulleys...

Unit 7 Word Search Quiz 2023-02-23

11 Items: something dangerouspull, aim, squeeze and sweepcut off the oxygen from a fireto cause something to stop burninga form of energy produced by a firea group of people who have gathered togetherto remove yourself or someone from a dangerous placeto cover something in order to keep it from growing or...

Freshwater Word Search 2023-03-28

11 Items: Where 25% of freshwater is found.ridges that separates watersheds.A lake made by people using a dam.Any water not found in oceans or seas.A wetland that looks like a flooded forest.___from rain and melting snow forms streams.The land area that supplies water to a river system.A wetland that is grassy and covered by shallow water....

Board Mania 2025-08-29

11 Items: Buy and trade properties to bankrupt opponentsMake words on a board using letter tiles for pointsGuess coordinates to sink all your opponent’s shipsMatch colors or numbers to play all your cards firstJump over opponent pieces to remove them from the boardPlace hands and feet on colored circles without falling...

Chapter 8 and Chapter 3 Physics Review 2025-01-17

10 Items: The force used to do workThe rate at which work is doneDetermining the components of a vectorThe energy that is stored and held in readinessQuantity requiring both direction and magnitudeThe vector sum of two or more component vectorsThe force and distance through which an object is moved...

Vocabulary Puzzles 2024-04-26

14 Items: a short crya faint cryan evergreen busha force against youtired and exhaustedfighting or arguing noisilythe feeling of regret sadnessmove swiftly and fast smoothlyvery quiet barely hearing the sounda quiet and soft speech of somethinga land outside of the main part of landNot being able to tell what's happening next...

Rebecca & Sam Tye the Knot! 2025-05-18

14 Items: Current locationSam is becoming aBecky is becoming aBeckys new last nameNicki is now beckys ...City where the wedding isThe Bride and Grooms Pet DogThe Bride and Grooms Police DogFemale hair accessory worn by a brideWhat the bride wears on her wedding dayThe reason the couple are getting marriedLegal paper document showing proof of a marriage...

POP QUIZ 7 2025-11-12

14 Items: TBADIYGOATMoMAYOLOFOMOTotally, completely, entirelypersonal identification numberof only average quality, not very good, MIDSELF CONTAINED UNDERWATER BREATHING APPARATUSa sudden, violent gust of wind, often with rain or snowthe scientific study of the Earth's atmosphere and how it causes weather changes...

elafant and piggy 2016-05-26

15 Items: garldpiggyelafantiaMAFROGTHINKYOUmowillemsTHINKOROMAhappypigdayMYFRINDISSADWEAREINABOOKELAFANTPIGGYIWILLTAKEANAPIRILLYLIKESLOPWAITINGISNOTEAZYMYNEWFRINDISSOFUN

Elephant and piggy 2016-05-26

15 Items: piggygeraldelephantiaMAFROGTHaNKYOUmowillemsTHaNKOROMAhappypigdayWEAREINABOOKMYFRIeNDISSADIWILLTAKEANAPELephANTPIGGYIReaLLYLIKESLOPWAITINGISNOTEAsYMYNEWFRIeNDISSOFUN

Christianity and War 2017-03-15

15 Items: oldnewteneyewarloveholyjesustoothmurderrevengemuslimsblessedcrusadestestament

RNA and DNA  2018-05-21

15 Items: CodonSugarUracilAdenineThymineGuanineCytosineProteinsAminoacidPhosphateTranslationTranscriptionTemplatestrandCharacteristicsComplementarystrand