atoms and molecules Word Searches

Elements and Compounds 2024-12-16

14 Items: Form when two or more different elements combineIt is a substance that is dissolved in a solventIt is the result of dissolving a solute in a solventIt is a substance which can dissolve other substancesA mixture in which the composition is uniform throughoutIt is the act of decreasing the concentration of a solution...

evening Time and weekend and get away 2023-04-19

49 Items: ginfrybeermliktimewinekissblueyorkeggsfishtacocokecakemarsdancedrinkwaterhappyuncleharrysweetwarpsapplebaconsantapepsifantasweetfamilysistersummerpotatodinnerboxingwalkingweekendbrothersausagebelfastairportchickencollegeshoppingeveryonesandwichbeefsteaknewcastlechristmas

Native and Indigenous Authors, Illustrators, and Titles 2024-10-18

34 Items: SilkoSmithNelsonOrangeQuigleyNewSunsJoyHarjoBirdsongCeremonyGratefulRoanhorseMightyRedBerrySongJulieFlettNickMedinaBrianYoungCrazyBraveIndianLakeThereThereTraciSorellWarriorGirlSheineLendeBurialGroundGrandmasTipiJingleDancerWaterMonsterShermanAlexieLouiseErdrichMichaelaGoadeRedBirdDancedParttimeIndianAngelineBoulleyStephenGrahamJones...

Ankle and Lower leg Anatomy and Injuries 2025-01-17

25 Items: TALUSTIBIACUBOIDDISTALMIDDLEHALLUXFIBULASPRAINSTRAINSOLEUSDELTOIDTARSALSTURFTOELIGAMENTANTERIORPROMIMALFRACTURENAVICULARPOSTERIORCALCANEUSPHALANGESCUNEIFORMSMETATARSALSSTYLOIDPROCESSPLANTARFASCIITIS

Grace and Ben’s River Voyages and Trivia 2025-08-26

30 Items: FinDIYHydeFishHGTVLovePearlDrumsCoralBanditForeverWeddingAquariumMichiganTinyhouseWisconsinNewlywedsThe Mother of the BrideThe Mother of the GroomThe Bride’s favorite foodThe Grooms favorite sportThe name of the tiny houseThe first state we moved toWhere was our last vacation?The Bride’s undergraduate Alma materThe city the newlyweds now call home...

CHAT Terms Word Search 2025-10-06

7 Items: To investigate how a text gets producedTo investigate how people conceptualize and plan to produce a textTo investigate how people take up and use a text they’ve interacted withTo investigate all of the complex practices people do as writers create textsTo investigate where texts go in the world so that people might interact with them...

Jump5 2023-09-26

11 Items: yalibbychrislesliearoundbrandonnastahawelcomebrittanyI can doand beast

Jump5 2023-12-16

11 Items: yalibbychrislesliearoundbrandonnastahawelcomebrittanyI can doand beast

Allison Romero musical theater 2024-02-20

11 Items: moviesongsdanceAwardanniemusicaltheaterbroadwaybillboardof the Operaaand The Beast

Build Up 3.3 Welcome to the Animal Kingdom (2) 2024-06-11

14 Items: Rivers and Lakes.The top of mountains.This habitat covers 70% of Korea.Cutting down trees in the forest.A big cat that lives in rainforests.The only continent without grasslands.To use less of something like electricity.The largest habitat (it is filled with water).The plants that give the grassland habitats name....

TechnologyJourney 2025-01-30

14 Items: — a theme that is repeated many times- people who make up new things and products.- a new or improved idea, device, product, etc.— to break a hard problem up into smaller, easier ones— finding and fixing problems in your algorithm or program— a placeholder for a piece of information that can change...

Movies 2025-11-12

12 Items: ABBA songs and Greek islandsA classic love story in MoroccoA humble boxer becomes a championA giant shark attacks a beach townA smart little girl with magical powersA Roman fighter seeks revenge in the ColosseumA magic carpet, a lamp and a genie in the desertA romantic story between a living woman and a ghost...

Come Word Search 2025-05-07

11 Items: heredowntalkwavesreplaylightsmirrorscontroljealousand get itimpossible

Plane and Solid Figures 2014-01-22

29 Items: rayandLinecubeconefaceedgeanglesquarespherevertexscalenepyramidparalleltrianglediagonalcylindersimilar.rectanglecongruentrightanglelinesegmentequilateralintersectingperpendicularquadrilateralparallelogramregularpolygonrectangularprism

THANKSGIVING 2021-11-22

32 Items: PIEANDPIEMILKCORNBEANCORNYAMSSAUCEROLLSGRAVYSWEETJUICEGREENBREADTURKEYMASHEDPOTATOBUTTERPARADEPOTATOCELERYCHEESEROASTEDCANDIEDPUMPKINSTUFFINGBISCUITSMACARONICRANBERRYCASSEROLEVEGETABLES

Skittles Word Search 2024-01-18

20 Items: fishdotsdudscornyorknerdstaffykissesreesesand ikelolipopsnikerskit-katskittlesairheadsstarburstgummybearscotton-candyjollyrancherssourpatchkids

INDOOR GAMES 2024-04-27

25 Items: unoclueFourriskludochessjengacardspokertaboosorrybridgecluedoboggletwisterPursuityahtzeemonopolyscrabblecheckerscharadesoperationpictionarybattleshipand Ladders

Sense-Sational Squishy Sloppy Gloppy Goopy Soupy Gooey Oozy Day 2025-09-25

25 Items: RedIckyOoeyBlueClayToysGooeyGreenSmockPaperTouchApronOrangeYellowPurpleIndigoVioletPaintsHorsesSquishyRainbowPaintbrushHot-PocketsFinger-paintsMacaroni-and-Cheese

Wednesday 2025-10-06

21 Items: webEnidHydeAjaxWeemsAvianCrowsAgnesMyersTylerThingOrtegaroomieXavierHorrorSchoolGalpinOutcastWednesdayNevermoreand white

Yellow List 2025-12-04

29 Items: toohaswhoforsheyouandseethewasarecancomegoodlookhelpdoesplaythisheresaidwhatwanttheyhavelikewithwherelittle

Science 2024-05-06

38 Items: and diffusedpressure exerted by aira measure of the amount of storagedevice for measuring atmospheric pressurethe quality of being hot; high temperature.the outermost region of a planet's atmosphere.winds that occur in belts that go all around the planetvapor water in a vaporous form especially when below boiling...

Epidemiology- Topic 2 2023-01-21

9 Items: E_______ ASSESSMENTE__________ STUDIESDATA A______ TECHNIQUESSOURCE OF DATA: Q__________WHAT DO PUBLIC HEALTH LABORATORIES DO? F____ SAFETY.WHAT DO PUBLIC HEALTH LABORATORIES DO? P______ DEVELOPMENT.S________ SOFTWARE IS USED FOR DATA MANAGEMENT AND ANALYSISWHAT DO PUBLIC HEALTH LABORATORIES DO? T_______ AND EDUCATION....

Chapter 4 Word Search 2023-11-16

34 Items: Organelle of protein synthesis.Viscous fluid enclosed by the nuclear envelope.Small circle of DNA in some bacteria and archaea.Long, slender cellular structure used for motility.Barrel-shaped organelle from which microtubules grow.This eukaryotic organelle specializes in producing ATP.Semifluid substance enclosed by a cell's plasma membrane....

Safety Week 2023-08-11

11 Items: ehsoshaWeekConeDrillhazardGlassesStationforkliftearplugsand Trips

Agility Word Search 2024-11-11

10 Items: DrivenAgilitySolvingBuildingInitiativeInnovationTechnologyProductivityCommunicationand Social Awareness

Forces 2024-11-23

10 Items: pushpullforcetwistforcefrictionmagnetismresistanceand gravitycontact force

Basketball Word Search 2025-10-16

10 Items: slideswingseesawsoccera kitea bikebadmintonbasketballrollerbladehide-and-seek

Gavekort til.. 2025-12-08

10 Items: IkeaNettoFøtexSilvanNyborgHilfigerSelectedand JonesTøjekspertenNew Tomorrow

Search Party: Presidential Runner-Ups 2024-11-03

5 Items: Election of 1988Election of 1996Elections of 1952 and 1956Elections of 1832 and 1844Elections of 1896, 1900, and 1908

Dream Careers ( Big Dreams for Little Heroes! ) 2025-05-03

5 Items: DETECTIVE: An investigator who follows clues and solves mysteries or crimesFIREFIGHTER: A brave rescuer who fights fires and saves lives in emergenciesASTRONAUT: A person trained to travel beyond Earth’s atmosphere and explore spaceARCHITECT: A professional who plans and designs buildings and structures for people...

Ares Word Search 2025-11-10

10 Items: A God of musica God that controls warA God of war and wisdomA God that controls waterA God that sends messagesA God that controls lightingA God of hunting and animalsA God that controls celebrationA place where they worshiped the godsA God that controls fields and farming

Europe/ Eurasian Geography 2025-11-13

10 Items: TaxesEnemies entering by force.An old decayed plant materialMeaning little or no rainfallSupporting or advertising somethingDefined territory with its own governmentA forest area that provides valuable resourcesA chemical that kill harmful insects and weedsA country in the Eastern Europe and North Asia....

November Safety 2024 2024-11-11

12 Items: Acronym for Waste Anesthetic GasesDo not over inflate ______________ tubes!Adequate ___________ is key to reducing WAGs.Loose-fitting tubes/masks are common source of ________ gas.Making repairs, correcting problems, or performing routine checks.When note in use, the __________ and oxygen should always remain off....

Icecream word search 2022-10-05

15 Items: coffeeeggnogvanillapumpkinchocolatestrawberrycappichinogingerbreadcookie-doughbirthday-cakehot-chocolatebananna-pecancookie-monstercookies-and-creammint-chocolate-chip

1 2024-04-17

15 Items: WopBerryvinylHaleyradioguitarWoogiePresleyRichardjukeboxRecordsand Rollplattersteenagerdancehall

OUTDOOR GAMES 2025-05-19

16 Items: TAGROPERACERACESAYSCATCHOF WARCHAIRSMUSICALMARBLESPLAYINGAND SEEKTHE FLAGKICKBALLHOPSCOTCHDODGEBALL

Glassbreaker! 2025-06-26

8 Items: Cluck Cluck.Pencil and ___."Keep me warm!"You drool on it."Heaven's tears".Soft, sweet, edible.Packages come with it.Earth and "Heaven's tears".

trs22 3b bt4 wk15 pt2 2022-07-06

10 Items: adj.Not tidy.n.The wife of a king.n.Special or fun clothes.n.The son of a king and queen.n.The daughter of a king and queen.n.A computer that can fold and be put in a bag.n.Use your hand make something move through the air.n.Stuff that is made of very tiny pieces, like flour.n.A big party in the street with music, dancing and costumes....

unit 9 Word Search Show Your Moves 2024-10-21

10 Items: elegant and relaxing musicTheir melodies are very varied.originating from a country or regionmusic with rhythm, more moving and fundelicate when playing, satisfactory soundloud music, somewhat noisy and with electronicspopular genre music developed in the United Statessomething sensitive to hearing but remains elegant...

Quarter 2 Practice 2024-11-26

10 Items: honest; telling it as it isdelicate, small, and prettyable to be done or carried outhaving a pleasant or friendly attitudenever ending or changing; happening all the timefeeling doubt or uncertainty; not to be fully trustedrefusing to be persuaded or refusing to change one's mindtaking care and putting steady effort in one's work or duties...

Eagle Day 2025-04-03

10 Items: A battle to the last chair.Where all the Eagles linked up.Many opportunities to win throughout the day!Provided nourishment to our Eagles and visitors.Careful not to get soaked in the ______________.Helped provide essential knowledge to our Eagles.Where our Eagles came out and shook their tail feathers....

Sip & Solve 2025-05-04

10 Items: Nate's middle nameNate's favorite cookiePreferred type of proteinThe bride's favorite liquorYears the couple was long distanceThe city Nate and Christina are fromThe city Nate and Christina live nowThe name of their late jalapeno plantWhere the couple's first apartment wasThe sport that both Nate and Christina did

Ligamentous Word Search 2024-10-10

10 Items: – A form of exercise that relies on the use of oxygen.– The ability of muscles to sustain activity over time.– Injuries caused by repetitive motion or excessive strain.– System that includes muscles and bones, often examined in PPEs.– Programs designed to enhance physical fitness and prevent injuries....

HOW A TWO-TRANSISTOR OSCILLATOR WORKS 2024-05-23

10 Items: 16,000 cycles per second is the same as 16,000 ___________.This two-transistor oscillator is an _____________ generator.The tone, in this circuit, comes from the ____________________ .A frequency of 10 Hertz is the same as 10 ____________ per second.This two-transistor oscillator uses an NPN and a _________ transistor....

Parris Word Search 2025-09-12

10 Items: Person from Barbados blamed for speaking with spiritsElderly farmer known for taking people to court oftenCommunity filled with suspicion and fear of the devilMan who speaks his mind and clashes with Reverend ParrisWise woman who tries to calm everyone and urges patienceYoung girl who will not wake up after the night in the forest...

Tiger Word Search 2025-11-16

10 Items: – A fast, black wild cat that hunts at night.– A small, clever animal with a long, bushy tail.– A wild dog that often lives and hunts in groups.– A large animal with one or two horns on its nose.– A spotted wild cat that can climb trees very well.– A large wild cat with orange fur and black stripes....

Geography Key Words - L1 2025-09-03

10 Items: the types of plants in an area or a regiona tool or instrument for finding directionsa sphere that is a model of Earth and most accurately represents ita physical feature on Earth's surface such as a mountain or a plainthe study of our physical surroundings and how humans interact with them...

icecream 2024-05-29

7 Items: twixdoughvanillasnickersand creamchocolatestrawberry

Kings of Judah 2025-11-11

17 Items: (642-640 BC) Assassinated by his own servants (Amon)(841 BC) Reign ended after he was terribly wounded (Ahaziah)(609-598 BC) Another "bad" king, whose name was changed (Jehioakim)(870-848 BC)good king, established religious practices (Jehoshaphat)(841-835 BC) Queen, Only female monarch who ruled over Judah (Athaliah)...

Kings of Judah 2025-11-14

17 Items: (642-640 BC) Assassinated by his own servants (Amon)(841 BC) Reign ended after he was terribly wounded (Ahaziah)(609-598 BC) Another "bad" king, whose name was changed (Jehioakim)(870-848 BC)good king, established religious practices (Jehoshaphat)(841-835 BC) Queen, Only female monarch who ruled over Judah (Athaliah)...

External Funding Entities 2025-06-11

10 Items: A type of charityThe largest funding entityA foundation type funded by company profitsAmerican Heart Association is considered one of theseConsisting of family, corporate, and professional typesOne type of federal agency that provides funding to U-MFunding sources on a smaller scale from the Federal Government...

SWEtacular Word Search_2 2025-09-12

5 Items: Creates and manages fundraisers and club merchHosts an annual STEM conference for high school girls.organizes social and collaborative events for SWE members.Engages the broader community students with STEM events and SWE volunteers.Coordinates the Big/Little program, SWE Connect, and bringing members together.

DSS Compliance Quiz #2022 2022-12-08

10 Items: A rule or directive made and maintained by authorityWhat is the short form for Civil Aviation Authority of Malaysia?Reservation and Ticketing latest updates, products, enhancement etc., are communicated companywide via this methodThe _ _ _ _ _ _ is the principal evidence of the contract of carriage between an airline and the passenger named on it....

Ubiquitous Word Search 2023-12-08

10 Items: To produce or provideEnthusiastic and eagerExtremely large or extensiveHumble submission and respectCease to resist an opponent, surrenderPresent, appearing, or found everywhereLacking originality and common, boring.To decrease gradually in size or intensityTo accept something reluctantly but without protest...

Zenith Word Search 2023-12-10

10 Items: Full of energy and lifeTo brighten or light upTo bring forth or elicitThe highest point or peakA faint sign or indicationCalm, peaceful, and untroubledTo think deeply or consider carefullyTo come together and form a single wholeTo shine brilliantly or impress intenselyA pleasing arrangement or combination of elements

evening Time and weekend and get away 2023-04-19

52 Items: ginfrybeermliktimewinekissblueyorkeggsfishtacocokecakemarsdancedrinkwaterhappyuncleharrysweetwarpsapplebaconsantapepsifantasweetsunnyfamilysistersummerpotatodinnerboxingsundaywalkingweekendbrothersausagebelfastairportchickencollegeholidayshoppingeveryonesandwichbeefsteaknewcastlechristmas

Skin Disorders and Diseases: Inflammation and Infection 2025-02-26

90 Items: LiceSitzStyeEdemaLaserLymphTineaViralAsthmaAureusEczemaHerpesImmuneOcularStressSulfurUlcersAllergyBullousFatigueIllnessPilarisPinkeyePruriusRosaceaScabiesSimplexSteroidSurgeryAbrasionAxillaryBlistersChemicalDiabetesErythemaGeneticsHormonalImpetigoNaproxenPerioralPeroxidePyogenesRetinoidRingwormVascularAcyclovirAntiviralBacterialFilaggrinIbuprofen...

Units 8 and 9 Prefixes and Suffixes 2025-04-18

30 Items: EvokeBoorishFatuousAbscondMysticalAberrantAbdicateEmigrateHerculeancinematicQuizzicalJudiciousEvaporatePeripheryPeriscopeProactiveAmateurishOutlandisheconomicalAutonomousCircumventProficientCircumspectPeripateticproliferateMetropolitanAuthoritarianIntergalacticCircumferenceCharacteristic

Earth Science 2025-04-14

10 Items: CRUST : The Earth's outermost solid layer.ATMOSPHERE : The layer of gases that surrounds the Earth.MAGMA : Hot, melted rock found beneath the Earth's surface.WEATHERING : The breaking down of rocks by wind, water, or ice.SEISMOGRAPH : An instrument that measures and records earthquake waves....

Hispanic Heritage Month 2022-09-23

6 Items: Arepa --> made from white corn. These are popular in Venezuela and ColombiaPandebono --> Colombian Cheese Bread. Made from corn flour and cassava starchChoco Flan --> A moist cake that is made with chocolate cake and caramel drizzleArroz Con Pollo --> Costa Rican Dish. Combines white rice, shredded chicken, and spices to make a great dish...

food 2023-08-10

6 Items: felinescary roarsbig and grayMan's best friendanimal with tusksstriped black and white

Revision time 2023-08-29

17 Items: to shoutsynonym of tombsynonym of expelopposite of strongcloth used at the top of a bedname of the poems main charactera very scary or frightening dreama bird of prey that eats dead animalssocially correct and with good manners.ugly and unpleasant.Similiar to ghoulishkind, helpful and caring for other people...

World War 1 2025-03-20

12 Items: An explosive used to destroy submarines.Monetary payment is used to right a wrong.Naval submarines used by Germany in World War 1.A position of remaining neutral in times of conflict.African-American Regiment that fought on the front lines of World War I with the French....

types of candy 2015-04-24

6 Items: andm&mssmartiesskittlesbubblegumlollipops

Career and Vocation 2025-04-14

10 Items: BOTANIST : A scientist who studies plants.ZOOLOGIST : A scientist who studies animals.CHEMIST : A scientist who studies chemicals and matter.JOURNALIST : A person who writes news articles or reports.PHOTOGRAPHER : A person who takes photographs professionally.ECONOMIST : A person who studies the economy and money systems....

Unit 1 Vocabulary MHT 2025-09-04

10 Items: EthosSynergyMicromanagementA general agreement reached by a group after discussion and collaboration.Uncertainty or unclear situations where multiple interpretations are possible.A leadership style where one person makes all decisions with little team input.The ability to make decisions and work independently without constant supervision....

Word Search Puzzle 2024-08-07

10 Items: One of the "3 As" of rural marketingThis analysis helps organizations identify their internal positives and negatives.The additional satisfaction or benefit gained from consuming one more unit of a good or service.A Japanese term meaning "continuous improvement," focusing on incremental, ongoing improvements in processes....

LOUIS ZISTEL 2023-10-17

10 Items: is where cedar point was foundedLouis zistel founded an amusement parkLouis zistel is the entrepreneur i choseLouis zistel had a wife and a few childrenLouis zistel Never Gave Up And Always Kept GoingHe had to make sure everything was safe for everyoneAt cedar point they sell things such as clothing,plushies,and hats...

Code1 2024-12-03

10 Items: Who was Abraham's wife?Who was the first man God made?What did God create on the first day?Who created the world and everything in it?What special garden did God place Adam and Eve in?What did Adam and Eve eat that God told them not to?Who was sold by his brothers and later became a ruler in Egypt?...

duck 2023-12-19

7 Items: andand alsoducks areducks are alsofast in the waterthat helps them flysome thing that flys

Written Communication 2025-12-02

12 Items: clarify an idea or conceptdetails based on research or investigationto reason from detailed facts to general principlesput information into your own words and use examplesexamine an object, idea or event and offer an appraisalarrangement of events from the most important to least important...

SHARE Specials 2025-09-13

11 Items: SoupprepChiliCookingChickenMeatloafDeliverypotatoesSpaghettiCasserolesand Sour Meatballs

Medieval Word Search 2022-12-12

10 Items: The biblical birthplace of Jesus.The length of the Medieval Christmas celebration.Find the hidden bean in the bread, and be queen or king for a day!This vibrant bird was roasted in its feathers for the Christmas feast.This word, when broken down to its roots, literally means "Middle Ages"....

Kindness towards animals 2023-02-22

11 Items: Animals provide us with sThey give us c as petsThey can guide b peopleIslam f to treat any animals badlySome pets can really teach you a lot about fWe are allowed to keep birds and f as petsSome pets are meant to live freely and not kept in a cWe are only allowed to keep d as pets for security reasons...

Chronic Illness and Acquired Disability: Quality of Life 2025-11-26

11 Items: MSK chronic conditionMental health chronic conditionResponding adaptively to chronic disabilityLoss of this can involve a grieving process and adjustmentsWhat a patient might set themselves as part of their recoveryWho else is involved in improving their quality of life (inits.)(Something), psychological and social functioning needs to be addressed...

Dillon Singleton Ch.14 Vocab 2025-04-11

13 Items: A fluid's resistance to flowing.Amount of force exerted per unit area.Temperature at which a solid begins to liquefy.Increase in the volume of a substance when the temperature is increased.The process of a solid changing directly to a vapor without forming a liquid.The amount of energy required for a liquid at its boiling point to become a gas....

Word Search puzzle grade 3 2024-12-08

20 Items: A red fruitA round toyA white drinkA yellow fruitSomething you readFalls from the skyEaten for breakfastSomething you sit onSeen in the night skyShines during the dayAn animal that quacksA pet that says "meow"A pet that says "woof"An animal that can flyUsed for placing thingsLights up the night skyPretty and has a nice smell...

winter fun 2022-11-30

20 Items: Achieve top speeds down the dill!Blow it up and zip down the hill!Gather up the kindling and keep warm!Cannonball into the near frozen water!It's cold out there, so be sure to do this!Build this friend out of fresh packing snow!Built with hard work and bricks made of snow!Footwear that lets you walk on top of the snow!...

3B 0725 2022-07-23

39 Items: unsafea rocka truckon all sidesthink of againcovered with snowcautious in one’s actionsto get pleasure from somethingthe process of doing somethinga bird that loves stealing thingsto produce leaves to begin to grownot containing any things or peopleone of the four periods of the yearto take something without permission of the owner...

Multiplicity and Diversity 2013-12-01

19 Items: thedovelandartecologyherkindWoodstockannesextonIhaveadreamspiraljettyfeministeraralphellisoninvisiblemanjohnpaulfilojonimitchellbettyfriedanblackidentityconceptualartdoublenegativeminimalistmusicyouthandrebellion

Days and months 2016-03-15

19 Items: MayJuneJulyMarchAprilMondayFridaySundayAugustTuesdayJanuaryOctoberThursdaySaturdayFebruaryNovemberDecemberWednesdaySeptember

David and Mephibosheth 2018-09-09

19 Items: GodSaulkindkingfarmlandDavidhonortableobeyedIsraelpalacefriendspromiseinjuredJonathankindnessprotectedMephibosheth

skitlles and pickles 2018-03-27

19 Items: drywaysoakglowdrewholdcrewjailsoldbindwavecrowgrindsneakfeaststeeplightsceneschool

Months and Days 2018-10-22

19 Items: MayJuneJulyMarchAprilAugustSundayMondayFridayJanuaryOctoberTuesdayFebruaryNovemberDecemberThursdaySaturdaySeptemberWednesday

DAYS AND MONTHS 2022-03-21

19 Items: MAYJUNEJULYMARCHAPRILMONDAYFRIDAYSUNDAYAUGUSTTUESDAYJANUARYOCTOBERTHURSDAYSATURDAYFEBRUARYNOVEMBERDECEMBERWEDNESDAYSEPTEMBER

Number and color 2022-08-25

19 Items: 035191711204016ungubiruhitamputihhijaukuningjinggaabu-abumerah muda

ritual and routines 2023-01-06

19 Items: kindtardyleaderpleaserespectpreparedthankyoureferralnohoodiesrestroomsdetentionphonecalldisciplinepermissiondirectionsconsequencesilentlunchnocellphonesfiveminutebreak

Relationship and Socialising 2023-03-26

19 Items: lovemediadatingfamilydatingdivorceromancemarriagebreakupslanguageteamworkdynamicsparentingfriendshipnetworkinginfidelityresolutionself-esteemcommunication

Candles and Cocktails 2023-10-28

19 Items: oakpineambercloveearthyautumnwarmthnutmegcandlespumpkincinnamonhazelnutcocktailsharmattandryleavessandalwoodconcretejargingerbreadholidayseason

Toys and Games 2024-03-10

20 Items: cartopdollballbeargamekitehooptrainplanegamespuzzleblockspuppetskatesrocketbicyclebuildingcarousel(repeated)

sports and school 2024-04-26

19 Items: tracksportssoccerhockeyhockeytennisschoolfrisbeerunningwalkinglacrossefootballbaseballkickballhomeworkteachersstudentsbasketballvolleyball

Romeo and Juliet 2024-05-03

19 Items: abramnurseparispeterromeojulietpotmanprincesamsontybaltanthonycapuletgregorybenvoliolawrencemercutiomontaguerosalinebalthasar

HEALTH AND MORE 2024-05-05

19 Items: virusremedyclinicdanieldiseasesurgeonpatienttherapyezekielhygienemedicinepharmacyphysicalfracturesanitaryhospitalepidemicinfectiontonsillitis

Pizza and Subs 2024-12-26

19 Items: subspizzapastawrapssaladwingssteaksshrimpcalzoneStrombolimushroomspepperonionionringsquesadillagarlicbreadfriedpicklesboardwalkfriesjalapenopoppersmozzarellasticks

Sprunki and more 2025-01-16

20 Items: TNaLoJeSkIsHopLopGymLisJijRaarYourFreeLslsLslsiDiskSprunkiKskmsixUs”slijten

EMOTIONS AND FEELINGS 2025-02-27

19 Items: joysadfearlovecalmangryhappyboredproudscaredamazedexciteddisgustanxietyhopefulplayfulconfusedcheerfulsurprised

Immigration and demographics 2025-03-04

21 Items: Legal membership in a country.Official count of a population.A society with many cultural groups.Population growth through birth rate.Official permission to enter a country.Emigration of educated or skilled workers.A person forced to flee their home country.Moving to a new country to live permanently.Leaving one’s home country to live elsewhere....

Phineas and Ferb 2025-04-10

19 Items: FerbCarlPerryPinkyRogerStacyJennyAgentPBufordJeremyIrvingDjangoPhineasCandaceBaljeetVanessaIsabellaHeinzDoofenshmirtzMajorFrancisMonogram

August and Jones 2025-08-15

19 Items: eyefarmhomesickJonesmodelfootycancerAugustletterditherinspireoutcastarchetypeProstheticdisabilitystereotypeinspirationextraordinary

school and eduction 2025-10-22

19 Items: TattoRigidapplymusicbullyscrapehockeyBeanBagArrangepassiontroubleprovideFlexibleMistakesDonationstressedExhaustedattentionconcentrate