atoms and molecules Word Searches

Crime and punishment 2023-03-15

16 Items: goodevilcrimedeathjusticepenaltymoralitypunishmentconscienceprotectiondeterrencereparationforgivenessretributionreformationvindication

S and Z 2023-03-29

16 Items: letmilkknotwrapkneecrieddriedwhileknownknifeknockwrongwristaloudwrinkleexpress

North and South 2023-05-23

16 Items: ironricenorthsouthshipsriverscitiescottonindigotobaccotextilessugarcanewaterpowerplantationsmanufacturingindustrialrevolution

Deborah and Barak 2023-09-09

16 Items: godarmykingbarakbravejabinjudgepeacebattlecanaanisrealsiseradeborahvictorychariotsobedient

Algorithms and Programming 2024-04-25

16 Items: listindexstringelementmodulusvariablealgorithmselectioniterationsequencingexpressionbooleanvaluecodestatementlistoperatorsdataabstractionlogicaloperators

SLEEP AND DREAMS 2024-05-27

16 Items: NAPDREAMSINSOMNIACATAPLEXYREM SLEEPPARASOMNIANARCOLEPSYNIGHTMARESHYPNAGOGICSLEEP APNEASLEEPWALKINGSLEEPTALKINGNIGHT TERRORSSIGMUND FREUDCIRCADIAN RHYTHMRESTLESS LEG SYNDROME

Wars and Battles 2024-06-12

16 Items: onetwocoldddayciviltrojanvietnamantietamwaterlooyorktowngettysburgstalingradthirtyyearsrevolutionaryeighteentwelvespanishamerican

PCSH Wordsearch Quiz LT2 2023-11-06

10 Items: value of the goodsneeds which are basic to mangoods used to produce other goodsdevice or money used for exchangemost important factor of productionindicator of progress and developmentmay refer to import and export of goodsphysical and mental effort exerted by mana branch dealing with the small parts of the eco...

Chapter 10 Laboratory Procedures 2024-04-16

14 Items: after eatingaka fasted or before eatingcontains RBCs WBCs and plateletsmultiple samples can be collectedno anticoagulent, blood is clottedserum is cloudy or white, high in fatused for morphology, lavender top tubeused for blood chemistry, green top tubeno anticoagulent, layer to separate serumAKA microhematocrit, percentage RBC in blood...

Spelling/Vocabulary word search puzzle 2022-11-10

15 Items: not alivebring to lifestrong disliking.a small, yellow birdrelating to metaphysics.an animal that feeds on flesh.the form and size of a persons bodythe rebirth of a soul in a new body.a traveling amusement show or circus.a person qualified to practice medicine.relating to the body as opposed to the mind....

A Monster Calls: Vocab #1 2023-12-04

30 Items: a small sofarefuse to stoplean but strongin an unclear waynecessary for lifeconfused; perplexedto disturb or irritatevery scary or frighteningrise and move, as in wavesa look of anger or dislikea tall tower in a buildinga close friend or associateexpress pleasure with wordsa feeling of a lot of angerexert much effort or energy...

Unit 2 Review 2023-12-19

10 Items: Push or Pullyour mass plus GravityUnit to measure force(N)How much "stuff" you are made ofsomething you can build with snowForce that pulls things down to eartha tendency to remain unchanged and has a direct relationship with massFor every action (force) in nature there is an equal and opposite reaction....

Ancient History 2023-07-17

20 Items: 490 BCE Battle of _________.9500 BCE Settled _______ began.2560 BCE Great _______ of Giza.6000 BCE _______ was discovered.200 BCE Paper is invented in China.776 BCE ______ Games first recorded.323 BCE Death of Alexander at _______.508 BCE Democracy introduced at ______.1700 BCE End of _____ Valley Civilization....

INVENTIONS AND TECHNOLOGY 2023-05-12

10 Items: landlinedownsideexceptionshop-onlinefact-of-lifehere-to-staystop-and-thinkcontrol-remotelycomputer-literatebackup-your-files

Environmental Regulation in Mexico 2024-01-08

5 Items: main law in Mexico for environmental issues (abbreviation)one penalty for not following the Law on General Equilibrium and Environmental Protectionone topic/matter the Law on General Ecological Equilibrium and Environmental Protection coversit seeks to understand the vital connections between plants and animals and everything around them...

Unit 11 2024-04-25

9 Items: this zone has enough light for photosynthesislow level of primary productivity in lakes/pondshigh level of primary productivity in lakes/pondsContains 20% of the world’s available surface waterthis zone does not have enough light for photosynthesisAmount of water used for all purposes per person over a given time...

Jobs 2024-03-14

12 Items: Someone who catches fishSomeone who helps a doctorSomeone who cuts down treesSomeone who works in factorySomeone who works in a schoolSomeone who constructs buildingsSomeone who sells things in a storeSomeone who grows plants for us to eatSomeone who cleans and fixes our teethSomeone who gives us medicine in the hospital...

English Law Word Search 2023-09-13

25 Items: Dealt with major civil casesWrote the first Law Code of EnglandA systematic collection of statutes.A written law passed by a legislative bodyA difficult or painful experience, a trialA court of equity, as distinguished from a common-law court.A legal document giving certain rights to a person or company...

United States History Chapter 2 2013-10-03

36 Items: ofandrulefreecostruralurbansuburbbranchbranchbranchchecksmarketprofitsupplydemandcultureeconomyfactorsservicerepublicjudicialbalancesmajorityindustryimmigratedemocracyexecutivetrade-offpatriotismpopulationgovernmentproductionlegislativeconstitutionmanufacturing

Each Word Search 2023-06-27

35 Items: iistosoatheandcanyoutheallwasnottageachwordmadeyourminddonthavethinkyoureluckylaserwouldfirstplacesearchhandlegottenconfusedestroymrmichaeldifficulty

100 Most common Words 1 2024-01-31

36 Items: isintohesaybutwasanyoutwayusenewyoudaytheandoneherknowbackmadesometimegivejustwentalsolikelikelookwillcometakewouldthereafter

Vocabulary Puzzles 2024-04-26

14 Items: a short crya faint cryan evergreen busha force against youtired and exhaustedfighting or arguing noisilythe feeling of regret sadnessmove swiftly and fast smoothlyvery quiet barely hearing the sounda quiet and soft speech of somethinga land outside of the main part of landNot being able to tell what's happening next...

Christmas Gift 2022-12-17

11 Items: 2 10s____ WonderSpeeding ____Yellow brick ____A round____ flightThere's no weird ____ optionDirectors Ethan and ____ CoenYou might get these from shavingThe state of the Boston Tea PartyLando Calrissian actor's first nameEarth, Wind, and Fire remembers this month

Chapter 6 Vocab Word Search 2022-09-27

15 Items: shows the expected cash outflowsplan for future in quantitative termsexpressing company's goals and objectivescompilation of all budgets/schedules preparedschedule that shows anticipated cash collectionsstandard achieved if operating conditions are perfectdifference between reported budget and realistic budget numbers...

Transport and countries 2014-11-23

16 Items: BusZugRadAutoUBahnWalesSchiffItalienSpanienEnglandFlugzeugFrankreichSchottlandÖsterreichStraßenbahnDeutschland

Tobacco and Alcohol  2015-03-17

16 Items: fiberhungercardiocalorieproteinaerobicexercisemuscularnutritionenduranceanaerobichealthyfatsflexibilitycarbohydratesphysicalactivitymuscularstrength

Energy and Forces 2018-01-29

16 Items: lightsoundpowernewtonjouleskineticthermalelasticnucleartransferchemicalpotentialefficientelectricalnewtonmetergravitational

Body and health 2018-12-08

16 Items: achebaldusualmusclepoisonthroatwrist.diseaseportionsurgerytherapywrinklemedicinepharmacyoperationcigarette

Fruits and vegetables 2022-10-19

16 Items: pearappleoniontomatocherrygarlicorangecarrotpepperpotatoesbroccolibeetrooteggplantpineapplestrawberrywatermelon

Comparative and Superlatives 2022-12-01

16 Items: bestworseworsttallereasierbetterfutherbiggersmallertallesteasiestbiggestcheapersmallestfurthestcheapest

Comparative and Superlatives 2022-12-01

16 Items: bestworseworsttallereasierbetterfutherbiggersmallertallesteasiestbiggestcheapersmallestfurthestcheapest

Comparative and Superlatives 2022-12-01

16 Items: bestworseworsttallereasierbetterbiggersmallertallesteasiestfurtherbiggestcheapersmallestfurthestcheapest

Recruitment and Selection 2023-01-05

16 Items: hireadvertemployvacancyrecruitanalysiscontractinternalexternalintervieweducationoccupationexperienceapplicationdescriptionshortlisting

Crime and Punishment 2023-05-25

16 Items: lawaimevilhatecrimedeathprisonorporalcapitalpenaltypunishmentdeterrenceprotectionforgivenessreformationretribution

shampoo and condition 2023-09-27

16 Items: capescalescalptonictowelcortexrotarycuticlemassagemedullaphscalesurfacedetanglefrictioneffleuragepenetrating

Fruit and Veggies 2023-10-05

16 Items: cornkiwiapplesmelonscarrotspeachesbananasorangescabbagestomatoespotatoescherriesmushroomscucumberspineapplesstrawberries

Women and minorities 2016-12-08

16 Items: LolaequalAliceCourtquotafemaleLatinosofficerSupremepolicingminorityPortlandWashingtonemploymentnewyorkcityafricanamerican

Moving and Lifting 2023-11-07

16 Items: pronedanglesupineassistlaterallogrollflowlerstransferrotationambulationergonomicsoppositionorthopedicpositioningphysiatristrehabilitation

Reign and Sophia 2024-02-14

16 Items: seemladyalongclosegraphboughtenoughfuturelaughedhistoryvillagehometownsettlerssomethingparagraphphotograph

Emily and Josh 2024-04-07

16 Items: mayloveemilygroombridebrownsjoshuamaggietigersfamilycheersmemphisweddingfriendshavenhallcovington

Food and drinks 2024-06-09

16 Items: oilhamteaporkbeefsaltcakesaucelemonkebabsugarsaladcheesepeppercoffeemushrooms

CPPI Team Building June 2023 2023-06-27

12 Items: (USDA Innovation Hub)(Diabetes Prevention Program)(One of IPHI’s 3 centers of work)(One of IPHI’s 3 centers of work)(One of IPHI’s 3 centers of work)(Illinois Public Health Institute)(Building Resilient and Inclusive Communities)(State Physical Activity and Nutrition program)(Coalition founded, managed and staffed by IPHI with a new name)...

International Banking and the Federal Reserve 2022-09-20

11 Items: The central bank of the U.S.International banking act of 1978Foreign bank supervision act of 1991banking that deals with foreign affairsthe wealth and resources of a country or regionDeposits; examines and supervises financial institutionsLegally allowed to accept monetary deposits from consumers...

M1 Revision 2023-07-15

15 Items: Games that people try to win.I _______ (100%) brush my teeth.A patio is in your ____________.Free time during the school day.This tells someone where you liveMy favorite ____________ is a guitar.Last year I was a ____ at a dog charity.My friend and I sing in the school ______.Your ____ tells someone where you were born....

what color is/are ...? 2024-02-21

18 Items: it's/pink.it's/gray.it's/yellow.they/are/blue.they/are/black.they/are/green.they/are/orange.it's/black/and/white.what/color/is/the/scarf?what/color/is/the/shirt?what/color/is/this/skirt?what/color/are/the/boots?what/color/is/the/t-shirt?they/are/brown/and/purple.what/color/are/the/shorts?what/color/are/these/jeans?what/color/are/these/pants?...

Pub Crawl 2023-01-08

7 Items: hausRoadRoomberkstoadslandmarkfive and dime

Earth and Space Science 2023-03-20

16 Items: a medium-sized star in our solar systemTrue or False-The sun orbits the Earth.the way in which the Earth slants on its axisThis planet is made of gas and has a very long orbit.Earth’s closest star and the center of our Solar SystemThe 4 planets that have long orbits and are made of mostly gas...

Rojo Word Search 2023-03-07

20 Items: color of grasscolor of the sunMan's best friendcolor of the oceanking of the junglefruits grown on vinestom from tom and jerrySpongeBob lives in onejerry from tom and jerrymonkeys ¨favorite¨ fruithad a color named after itthe color of cirrus cloudsbiggest animal in the worldthe color of stratus cloudsfruit that rhymes with tango...

Of Mice and Men vocab 2024-02-23

25 Items: deep respectanxiety or fearmocking laughterappease or softenlook at thoughtfullyflattering to pleasedisappointed and sadrepetitious and dulldeserving condemnationsullen and ill-temperedquick to argue or fightdisrespectful, demeaninggreat sorrow or distressunexpected words or actionsindication of a future eventunfriendly, cool, or distant...

Wedding Sip and Search 2024-03-28

22 Items: Couple's dogs nameBride's middle nameBride's birth monthGroom's middle nameGroom's birth monthBest mans first nameGrooms favourite filmNumber of bridesmaidsBride's favourite filmGroom's favourite drinkBride's favourite cocktailCouple's favourite TV ShowCouple's honeymoon locationBride and grooms favourite bandFootball team the groom supports...

Unit 7 Word Search Quiz 2023-02-23

11 Items: something dangerouspull, aim, squeeze and sweepcut off the oxygen from a fireto cause something to stop burninga form of energy produced by a firea group of people who have gathered togetherto remove yourself or someone from a dangerous placeto cover something in order to keep it from growing or...

Freshwater Word Search 2023-03-28

11 Items: Where 25% of freshwater is found.ridges that separates watersheds.A lake made by people using a dam.Any water not found in oceans or seas.A wetland that looks like a flooded forest.___from rain and melting snow forms streams.The land area that supplies water to a river system.A wetland that is grassy and covered by shallow water....

generic wrod search 2024-04-26

12 Items: Having wisdom, like an owl!It means not giving up easily.a quick comeback to an insult.It is a sword from the old east.Bland and dry imagination.. sad.A formal agreement you can't break.Good luck in discovering new things.Not doing something for a long time.Silly and happy, innocent like a child.Harsh laws or rules, like the Soviet Union....

stuff 2021-03-10

38 Items: aainandkidthecarunotophatwithsomefishdoessnowiPadwinewithwithHumanwhiletheirphonehumanshonerslightsinsidemermaidgettingmarriedcoveredspeakernapkinsbottlessnowmanswimmingcomputermicrophone

Go Word Search 2023-02-05

35 Items: iagosoofmemyweupisforandbuthownowseewhothearefindwilllikecomethismanywithwhatheresooncameintofromtheyyourwhere

FOOD 2022-08-30

8 Items: A small, round cake or piece of breadAn oval, purple vegetable that is white insideA small round fruit on particular plants and trees.Food which is unhealthy but which is quick and easy to eatA small sea animal which you can eat, and which has a shell and ten legsA small, round, soft red or black fruit with a single hard seed in the middle...

Wonders of the World 2023-04-20

27 Items: Famous tilted structure in Pisa, ItalyWorld-class art museum in Florence, ItalyStunning white marble mausoleum in Agra, IndiaRose-hued city carved into the cliffs of JordanMysterious stone statues found on Easter IslandGift from France standing tall in New York HarborAustralian landmark with distinctive sail-like design...

Help the Earth-Recycle! 2022-10-02

11 Items: A process of converting wastes into reusable materials.The thin, hard outer layer of an egg which is very fragile.A slender woody shoot growing from a branch or stem of a tree or shrub.A material made up of very thick, stiff paper, usually pale brown in colour, used especially for making boxes....

If not SOD, then what? 2014-03-27

4 Items: andGrowthStrategyServices

scramble 2017-03-22

4 Items: funandcollove

Switching and Routing Terminology 2023-03-29

34 Items: A port that allows traffic from only one VLAN.A logical grouping of computers through segmentation in a LAN.A set of computers and devices connected in one physical location.A naming system that converts human readable domain names into IP addresses.A security feature on some switches that filters out untrusted DHCP messages....

scramble 2017-03-22

4 Items: funandcollove

Climate and weather 2023-05-15

15 Items: a warm water currentmeasures the air pressurechange in moisture contentmeasures the speed of the windmeasures the direction of the blowing windthe weight of the air pushing down on earthlarge bodies of air that have uniform temperaturemeasures the amount of precipitation that has fallen...

Misty Copeland's Ballet Moves 2024-01-29

8 Items: fouetté (whipped turn with feet)pirouette (twirl in place on one leg)plié (bend knees over toes, slow and controlled)passé (lift foot of working leg behind the knee of plié leg)jeté (extend one foot to leap in air and land on other foot)tendu (point toes before another move, such as ronds de jambe)...

Photo Word Search 2023-11-09

13 Items: lightto put togethera gas produced by photosynthesisan organism that makes its own foodan organism that can produce its own fooda specialized structure within a living cellan organelle in which photosynthesis takes placea green pigment within the chloroplast that absorbs light energya gas that green plants absorb that is required for photosynthesis...

Cancer and Cell Biology 2013-11-14

37 Items: UVandMenFairSkinRatesGenesCellsCancerBenignCancerDamageSmokingRapidlyDamagedGeneticSunburnExposureHereditySurvivalMultiplyMutationMultipleExposureAutonomyCigaretteSubstanceBreakdownMalignantInheritedExposuresRadiationGovernmentRegulationCarciogensDispositionUltraviolet

Skittles Word Search 2024-01-18

5 Items: memsnerdsskittlesand ikesdumb-dumbs

generic wrod search 2024-04-26

12 Items: Having wisdom, like an owl!It means not giving up easily.a quick comeback to an insult.It is a sword from the old east.Bland and dry imagination.. sad.A formal agreement you can't break.Good luck in discovering new things.Not doing something for a long time.Silly and happy, innocent like a child.Harsh laws or rules, like the Soviet Union....

APES Unit 11 2024-04-30

12 Items: Bottom of the ocean97% of water is ________Factor in water availabilityUnevenly distributed human needCover 71% of the Earths surfaceNot enough light for photosynthesisTransport water over long distancesamount of water used for all purposes per personOpen water, contains phytoplankton to photosynthesize....

Sip and Search for our Friends and Family 2024-02-25

42 Items: rosskerrkorthmasonpieszlyonsselkedugalheardwikolmuccicohenwagnerrottermanuelcairnsbonineringerwagnerbeckercalmacgomorifelczakallisongardnerdufaultridenerwarstlerlombardogrimaldicampbelllafrancesenkbeilpetersoneveslagemcknightlafranceouellettederkowskicarpenterbalamuckiruppenthaul

The Word Search 2023-01-05

4 Items: theoutalland

1-15 2023-04-13

4 Items: uptoandblue

Acid and Base 2014-04-15

18 Items: acidbaseacidbaseprotonstrongaqueoushydratedArrheniushydroniumtriproticconjugatedionizationamphiproticconcentrateddissociationBrosted-Lowryself-ionization

Women and minorities 2016-12-08

16 Items: LolaequalAliceCourtquotafemaleLatinosofficerSupremepolicingminorityPortlandWashingtonemploymentnewyorkcityafricanamerican

Clothes and furniture 2017-09-11

16 Items: hatbeddesksocksshoesdressjeansskirtchairclockjacketwindowposterT-shirtwardrobebookcase

fruits and vegetables 2018-03-28

16 Items: kiwibeetokracornapplemangopeachgrapebananaorangetomatopotatocarrotpumpkinbroccolistrawberry

Toys and games 2020-07-02

16 Items: cartagkitedollcardslimbolegospuzzlehangmanleapfrogcharadesdodgeballhopscotchjumpingropehideandseektic-tac-toe

Food and Drink 2022-11-09

16 Items: eggfishricecakemilkchipssushiapplecookiecoffeechickennoodlessandwichlemonadehamburgerorangejuice

Comparative and Superlatives 2022-12-01

16 Items: bestworseworsttallereasierbetterfutherbiggersmallertallesteasiestbiggestcheapersmallestfurthestcheapest

z and S 2023-04-13

16 Items: openironcloudchildbeginmatchwatchbatchsteelditchwomenchancespeechsourceexamplematerial

Citizens and Laws 2023-05-23

17 Items: lawlawbailcrimecourtfelonyprisonlawsuitstatutewarrantwitnessprocessfederalsuspectcriminalJeopardyprecedent

Acids and Bases 2017-02-16

16 Items: acidBasesaltdilutelitmusphscaleneutralsolutionalkalinehydroxidehydroniumindicatorionizationelectrolyteequilibriumconcentration

Marble and Peach 2024-07-24

16 Items: catroadtreeparkplayhousebullybirdsbrownwhiteorangecollarfriendsneighborsquirrelgroceries

stuff 2021-03-11

38 Items: aainandkidthecarunotophatwithsomefishdoessnowiPadwinewithwithHumanwhiletheirphonehumanshonerslightsinsidemermaidgettingmarriedcoveredspeakernapkinsbottlessnowmanswimmingcomputermicrophone

Biotechnology Research and Development Careers 2023-05-05

7 Items: Protein that acts like a catalyst in the cella biotechnology research and development careera biotechnology research and development careerequipment specialist a biotechnology research and development careerPatterns of inheritance and develop methods to influence genetic information...

Attic Word Search 2023-02-25

25 Items: support buildingthe front of a buildingthe rooftop of apartmenta space to park your vehiclethe lower part of the structurethe overhead surface of the roomThe lowest part or base of podiumtools to hold the door and windowthing to help you go to next floortools to sirculate the air in a rooma space found directly below the roof...

Cinema Eruption 2023-05-27

20 Items: - What surface is used to display a film?- What is another word for a movie theater?- What is another word for a motion picture?- What is the written text of a film called?- What is a colloquial term for a motion picture?- Who is a person who performs in a play or movie?- Who are the people watching a film in a theater?...

Vocabulary Word Search 2024-07-26

24 Items: The type of storyThe main characterSomeone in the storyWhere a story takes placeWhy the author wrote the storyThe ending of a story or resolveThe point of the story or main ideaThe point of the story or main ideaThe perspective the story is written inWhat happens in the story or the summaryThe reader, watcher or listener of a story...

Cover Letter & Resume Vocabulary 2023-10-18

12 Items: Emphasize the applicants overall capabilitiesOutline a brief description of the desired jobLists a brief description of the job responsibilitiesAccentuate responsibilities and capabilities of particular positions heldBrief summary of what the applicant can contribute to the potential employer...

j and g 2014-12-04

17 Items: TimelinerocksGrandRivercanyongranitePlateaucrystalsmineralsColoradoColoradoMesozoicdiamondssandstonelimestonePrecambrian

Value and Forms 2016-10-12

16 Items: TintConeCakeValueShadeBlackWhiteColorScaleFormsSpherePyramidArizonaCylinderThiebaudIcecream

ICE AND SNOW 2020-03-02

16 Items: HAILFLOEDUSTSLEETFROSTGLAZESLUSHSUNCUPGLACIERICEBERGFASTICEDIAMONDBLIZZARDSNOWFALLSNOWFLAKEAVALANCHE

Forces and Fields 2021-01-21

16 Items: repelprotonmagnetcurrentattractcircuitelectronmagnetismmagneticpolemagneticfieldelectricfieldelectricforcesmagneticforceselectricchargeelectromagnetismstaticelectricity

Revise and Edit 2021-04-15

16 Items: EDITCOMMARUNONWORDSREVISEPROMPTWRITINGFANBOYSCONTEXTSPELLINGFRAGMENTCOMPLETEQUESTIONQUOTATIONSPARAGRAPHSCAPITALIZATION

rules and obligations 2022-01-27

16 Items: mustneedrulesstudycleanshouldadvicefollowallowedhomeworkremembervoluntaryattentionsuggestionobligationsconcentrate

CELEBRATIONS AND FESTIVALS 2022-07-26

16 Items: mealballcardgiftparadecarolscandletemplegarlandbonfireconcertcostumecalendargreetingfireworksmistletoe

Meditation and body 2023-04-10

16 Items: chiyogasleepstresspilatesmassageexerciseherbalismnutritionmeditationhomeopathyrelaxationmindfulnessacupuncturereflexologychiropractic

Eid and Ramadan 2023-04-20

16 Items: eidlovehennadatesfeastmuslimmosquesweetstreatsfamilylanternfastingramadanholidaycrescentpresents

Kayla and Ryan 2023-07-31

16 Items: ryanlovekobenolamauihanakaylabeachwavessaintshawaiiturtlesunsetmaitaiemeraldbourbon

lost and found 2023-11-03

16 Items: smsfixgatewearsendfindpostshareranoutcollardeletereaderholidaythroughlostmydoganoticeboard