and the blade Word Searches

I Word Search 2026-01-15

40 Items: DODJBARPIEKISSVEILVOWSRINGSUITHOFFLOVEBRIDEGROOMDANCEDRESSTOASTAFTERHEELSPHOTOSPETALSAUGUSTCHEERSSUNSETFAMILYAND MRSFOREVERBOUQUETHOLLANDWEDDINGHITCHEDFRIENDSMARRIAGEMICHIGANOFFICIALHONEYMOONAND HAVENCOCKTAILSCUFFLINKSBOUTONNIEREPHOTOGRAPHER

DNV 2026-02-18

26 Items: RedDNRPlanorderScaleBoardpacketPurpleInjuryRoundsEMTALAConsentStationsign offServicesGrievanceNutritionPreventionAssessmentMedicationRestraintsDirectivesShift Reportand Procedurereconciliationback and verify

Young Cam Jansen and the Library Mystery 2024-06-06

18 Items: losetowerprintsweepsolveborrowcannedmysterysardineproudlyfavoriteaccidentbookmarkshoppingstickoutmagazinesontheloosesupermarket

48 2025-08-17

15 Items: Common traffic feature overseas.Traffic rules bikers must follow abroad.Ticket issued for breaking traffic laws.Testing a bike’s horsepower on a dynamometerA designated area for tire spinning and smokeDecorative thin lines painted on a motorcycleSewing on club insignia onto a vest or jacketCrafting protective gear from tough animal hide...

Birthday 2025-12-01

9 Items: Favorite cocktailCommon birthday treatVisiting a destinationGood taste, fashionableTo honor a day or occasionCommon birthday decorationDetermining your star signA way to gather and celebrateCelebrating the day you were born

animals and summer and christmas 2013-12-10

44 Items: catdogbeeflyfoxcowhotsunbirdliongoatswimsandtigerkoalasheepbeachoceantowelspadeangleSantaelveslizardmonkeyrabbitpossumbreezebuckettinselfamilychickenfriendselephantladybirdkangaroosunshineumbrellabutterflydragonflysunscreenChristmassandcastledecorations

fraya is a poo 2025-07-31

12 Items: aiisdoMEpooandyesdidthisfrayaALISSIA

Millies camp word serch 2025-08-05

12 Items: andcliprockwallclimbdinnerarcherypegwingcholatebreafastclimbingpillipiland

• W O R D S E A R C H • 2025-08-30

12 Items: byeaJforandJARSEarthMEDANKLINIKProjectBirthdaynatureaJREBOISASI

Percentage 2023-07-25

6 Items: entiregoods and services tax.a deduction from the usual cost of something.can refer to the monetary charge for borrowing money.relating to a system of numbers that is smaller than 1.a small or tiny part, amount, or proportion of something

Gender 2024-11-12

7 Items: The male version of a wifeThe male version of a waitressThe female version of a princeThe male version of an heiressThe female version of a bachelorThe female version of a conductorThe female version of a gentleman

Pirket Avot פרק ג, משנה א 2024-05-20

13 Items: We are going to a _Know where you are _Know from where you _You came from a single _We are in front of the King of _Don't focus too much on _ thingsWe must return our _ back to HashemEach of us came from a tiny _ of HashemAll we can take with us are Torah and _Know before Whom you are going to have to give a _...

Journey to the Sun 2025-10-21

12 Items: RadiateTo protect youCircling the EarthA type of magnetismA material to make platesSomething to do with the sunUsed to find out informationThe material that makes diamondsSomething that never happened beforeThe distance between the sides of a circleSomething that generates a lot of lightningWhat you use when you are in trouble to signal

Planets and fruits and people 2024-12-02

26 Items: SunBenLiaMarsMoonPearEarthPlutoGrapeApplefruitMangomelonMasonSaturnOrangepapayaFruitsJupiterPlanetscoconutKayloniKennedyHoneydewElizabethWatermelon

Water Transformations Word Search 2025-09-23

8 Items: When no more solute can dissolve in a solvent.To break down and spread out evenly in a liquid.A mixture where one substance dissolves into another.How much solute is dissolved in a certain amount of solvent.A nickname for water because it can dissolve so many substances.The substance that does the dissolving (like water in sugar water)....

engineering vocab 2025-05-01

7 Items: A limitation or restriction.Desired outcomes for an engineering design or product.An early functional version (a model, a mock-up) of a design.The overall objectives, functions and constraints of a project.The capabilities or tasks that an engineering solution is able to perform....

The fox and the crow 2025-04-12

6 Items: cawsnapleapfellowpraisescamper

World Word Search 2025-06-27

19 Items: GodPoollifelovedSavedof GodHeavenchosenhealedFamilySpiritChangerMatthewforgivenKids Campto win itmasterpieceof the weekof the world

Lions and Tigers and Bears 2024-01-28

32 Items: sunbearmasailionwhitelionbalitigerbrownbearpandabearpolarbearslothbearjavantigerjavantigerwhitetigerandeanbearkodiakbearafricanlionasiaticlionbarbarylionpantheraleobengaltigergrizzlybearcaspiantigercaspiantigermalayantigersiberiantigersumatrantigerspectacledbearsouthchinatigermelursusursinustibetanbluebearindochinesetigerasiaticblackbear...

Moses and the red Sea 2025-05-27

10 Items: देववाटपारमिसरकाठीमोसेससैनिकसमुद्रइस्राएलचमत्कार

Find the Food and Fun! 2025-06-14

10 Items: DadGrillPartyBurgerHotdogFamilyKetchupFriendsColeslawGranddad

Abuelo and the Three Bears 2025-10-20

10 Items: tomleoositosalsaridamdavidabuelofrijolestrencitastortillas

Percy Jackson And The Olympians 2025-12-02

10 Items: ZeusPercyHadesFuriesMedusaAthenaGroverMintaurPoseidonAnnabeth

The Reform and Abolitionist Movements 2025-12-17

10 Items: MariaStewartwomensrightspublicschoolsSojournerTruthFrederickDouglassHarrietBeecherStoweWilliamLloydGarrisonSecondGreatAwakeningSenecaFallsConventionDeclarationofSentiments

WEEK 5 - VOCABULARY "INTO THE STORM" 2025-11-19

10 Items: something dangerous or full of risk.to move or push something with great force.a loud, deep sound that rolls through the air.describes something extremely strong or intense.something that happens suddenly and with great energy.a moment when everything suddenly becomes still or quiet.a feeling of worry mixed with fear about what might happen....

Philanthropic word search (Hard) 2023-11-07

10 Items: having a friendly, generous and considerate towards othersabundant, plentiful, or having a large quantity or somethingact of using one’s wealth, resources, or time to benefit othersnot holding back, being harsh or severe in criticism or judgementHaving a kind and generous disposition or intention towards others...

FFA Creed Word Search! (Paragraph 3) 2025-08-11

15 Items: Something people buy.You do this every day.Needed to pass school.Very important in a team.A very good trait to have.People that love gardening.Mentioned in the FFA Motto.Something to do with money.Similar sounding to "soil"."Come on! You gotta think ____!"Something grocery stores do well.Get it from learning and training....

Vocab 1-3 2025-10-24

15 Items: recklessto returnto make impossibleto develop graduallystubbornly self-willedto regard with reverenceto exchange playful remarksto make as small as possibledescribed in well-known storiesextremely nervous or easily frightenedto feel about hesitantly with the handsa rope or chain used to fasten somethingto assign or distribute in shares or portions...

Clay's Vocab 2023-09-26

23 Items: made a choiceto show clearlycontaining nothingyoung cows or bullsa quantity of somethingto form a mental pictureto total numbers togetherreflection of sound wavesa way to get into somethinga value that does not changea breaking of a law or promisedownward measurement from a surfacea sweet, brown food that is made from cocoa...

Find and circle the words! 2025-08-24

10 Items: NATIVEHABITATPRIMATEMANGROVEPREDATORWILDLIFEENDANGEREDRAINFORESTPOPULATIONDESTRUCTION

Find the superpower and match! 2025-10-02

10 Items: flyfiremindswallsteleportinvisiblevery fastshapeshiftunderwaterto animals

Snow Terms 2026-01-08

12 Items: Of or having 6 sidesA small plane of an ice crystalThe outer edge of an ice crystalA flat, hexagon shaped, ice crystalwater in its gas form (gaseous state).The state of the air around something.Frozen water with a symmetrical structure.water that falls from the sky, in some form.A tiny bit of matter (dust, pollen, ash, etc)....

Feelings Word Search 2023-03-08

27 Items: shysorrylet downirritatedsurprisedvery scaredcause injuryeasily upsetuncomfortableextremely angryfuriously angryunable to relaxsorrow or miserysilly and excitableoverwhelming happinesseager to know somethinghushed or nearly silentanxious and apprehensivegreat happiness and triumphlively energy and excitementenvy of someone's advantages...

Random Stuff 2022-12-20

12 Items: BaldLoudColdOliviaAnnoyingThe timeMurderousThis PuzzleTeacher of 8CMy best friendThe title of this PuzzleWhat is the chemical Formula for Water

Goldilocks and the Three Bears 2013-10-20

10 Items: Bigbedbabymamapapabowlbearchairmediumlittle

Daniel and the Lion's Den 2025-08-28

10 Items: DenGodLawLionKingPrayAngelFaithDanielDarius

MILO AND THE MISSING COLORS 2026-01-05

10 Items: MILOTREENONNYRIVERANIMALFORESTLEAVESPARROTTORTOISEBUTTERFLY

Construction Word Search 2022-12-13

15 Items: pleaclotboysClownfatherissuesPriestsocialworkersfixationexecutedthe Clowncrawlspacethe victimsthree victims

Quaint Word Search 2025-11-17

13 Items: paths for bicyclesfull of life and energypaved with rounded stonesunwanted or harmful soundbusy and full of activityspace area for vehicles outsidebeautiful and visually charminggently sloping landscape featuresarea where only walkers are allowedparking facility below ground levelregular travel between home and work...

Keep your goals for yourself 2022-09-10

12 Items: wholecontentedto deceiveto tell, to make knownto reach a desired resultto accept or admit the existencebased on what is generally done or believedof the usual or ordinary amount, level, or ratethe state or quality of being dedicated to smth.the desire to do something, which is wrong or bad...

The Red Shoes pgs. 78-82 2023-07-12

12 Items: How did Karen feel?Who became very sick?What did Karen beg for?Whose voice did Karen hear?Who took care of the old lady?What did Karen do at the ball?What did Karen receive one day?She could never stop to ______.What did Karen put on for the ball?What did the old lady need a lot of?Who did Karen see at the church door?...

Search 45 - Shakespearean Quotations 2019-05-09

13 Items: AndActTwoTwoWhatLightRomeoSceneYonderWindowBreaksJulietThrough

Puzzle 1 2022-09-07

12 Items: atallandeveraboutearlyenougheitheritselfinterestimportantinformation

43565465342 2024-01-02

12 Items: andwiththiswordbookyourrelaxgiantbrainunwindsearchchallange

For Word Search 2024-11-08

12 Items: forsheredonebignothisandbluejumpintosaid

m100 search 2025-05-22

13 Items: ofitisinwasandyouwhythatthatwhatwhenwhere

What is a Pal Word Search 2025-09-07

12 Items: amatbesatmatdadmanandyouhelpwithplay

I Word Search 2026-01-15

40 Items: DODJBARPIEKISSVEILVOWSRINGSUITHOFFLOVEBRIDEGROOMDANCEDRESSTOASTAFTERHEELSPHOTOSPETALSAUGUSTCHEERSSUNSETFAMILYAND MRSFOREVERBOUQUETHOLLANDWEDDINGHITCHEDFRIENDSMARRIAGEMICHIGANOFFICIALHONEYMOONAND HAVENCOCKTAILSCUFFLINKSBOUTONNIEREPHOTOGRAPHER

Neuro Word Search 2023-05-02

15 Items: The Spinraza Program Lead.Same day delivery service.We call to do this for new patients.The extension 219332 is for what team?Another word for the supplies a patient may need.Any test claim questions for Evrs can be answered best by who?Any test claim questions for Emfl can be answered best by who?...

Wordmasters Word Search 2023-02-01

15 Items: Spending money freely.Something lacking in quantity.to bend the head or body forward.relating to or consisting of words.persisting for a long time/long lasting.politely refuse and invitation or offer.Poke someone with a finger, foot or object.intimidating in dress, appearance, or mood.To influence gently by caressing or flattering....

Wordmasters Word Search 2023-02-01

15 Items: Spending money freely.Something lacking in quantity.to bend the head or body forward.relating to or consisting of words.persisting for a long time/long lasting.politely refuse and invitation or offer.Poke someone with a finger, foot or object.intimidating in dress, appearance, or mood.To influence gently by caressing or flattering....

Science in action word search 2025-05-01

7 Items: Desired outcomes for an engineering design or product.An early functional version (a model, a mock-up) of a designThe overall objectives, functions and constraints of a project.The capabilities or tasks that an engineering solution is able to perform.The iterative process through which engineers develop solutions to meet an objective....

Earthquakes 2026-01-27

12 Items: What tool is used to measure earthquakes?What word describes the size of an earthquake?What are the large pieces of Earth’s crust called?What is a large crack in the Earth’s crust called?What do we call the shaking of the Earth’s surface?What layer of the Earth do tectonic plates move on?What plate movement happens when plates move apart?...

Word Search for Lovers 2025-11-04

16 Items: ughhh deanna and her?who made our favorite puzzles?what can you find in new jersey?we love rudy- even though hes ____who are ur two biggest opps? (romantic rivals)what did they include in the new hallmark movie?how did my grandma describe you when she met you?we sing this song when things are absolutely fucked...

Week 3 Review by Sharli Syed 2023-12-05

11 Items: A cell sends a signal to itselfanother name for a signal moleculeA cell sends a signal to a nearby cellA cell sends a signal to a cell that it is in contact withFirst step in cell signalling in which the signal molecule reaches the receptorThird step in cell signalling in which there is an activation of cellular response...

47 2025-08-17

15 Items: Maximum legal speed on roads.Legal process to challenge a convictionRides held in honor of fallen brothers.One complete circuit around a race trackPolice bust on a clubhouse or gathering.Legal requirement to wear head protection.When police pursue riders breaking the law.Riders gathering to push back against laws....

perfect 12 2026-02-17

15 Items: scholarlyto call forthclearly statedto show clearlyto be in love withto be delighted beyond measuretry to be equal to or better thanto pronounce words clearly and distinctlya departure, especially in a large group=to increase the value or beauty of somethingone who chose to leave his or her native country...

9321 Good Samaritan 2024-03-01

9 Items: A religious leader in the church.The person who takes care of an inn.A person who lives near you or anyone you meet.A person who steals from others, often using force.A place where travelers can stay, like a small hotel.A person from Samaria and were unfriendly to Jewish elite.A feeling of wanting to help someone who is hurt or in trouble....

Parts of a Residential Structure 2026-02-09

11 Items: RoofBeamFloorStairsColumnFramingFoundationFloor SlabExterior WallsWindows and DoorsInterior Walls and Partitions

The Jesus and Mary Chain 2024-02-05

10 Items: headonreverencedarklandsaprilskiessidewalkingsnakedriverjustlikehoneybluesfromagunsomecandytalkinghappywhenitrains

Poetry 2025-05-15

12 Items: the name of the poemthe composer of the poemthe T in TEEL stands forthe L in TEEL stands forrepetition of vowel soundsrepetition of consonant soundsPOP is an example of this techniquecomparing two things using like or asgiving inanimate objects human qualities'showing little eyes where to look is an example...

Movienight Word Search 2025-10-15

12 Items: The year they met.Where did they first meet?Where was their first date?The month they got engaged.The name of their first born.The name of their second born.The city where they got engaged.When is their dating anniversary?Where did they go on their first vacation?What is their favorite week night date activity?...

Double the Consonant and add -ed -ing 2024-12-20

18 Items: nappedbuggedslippedtrippedclippedplannedhugginghoppingdroppedjumpingwrappedslammedflippedwinningstoppingclappingskippingplanning

Unlocking the secrets of Atoms and Molecules 2025-08-27

18 Items: dnashellchainmatterprotonoxygensciencenucleusneutronnumberselementhydrogenmoleculepatternsmaterialsparticleselectronsbyproduct

Capstone - National Nursing Shortage 2025-11-25

4 Items: What will exceed the supply of nurses in the near future?Who can promote structural empowerment in nursing work environments?What is an important tool in addressing the challenges caused by the nursing shortage?What kind of violation exists when nurses do not meet expectations and guidelines laid out in the Nurse Practice Acts?

Waves - Reese Delger 2022-11-28

10 Items: measurement of displacementlowest part of a transverse wavehighest part of a transverse wavewhat the frequency is measured inthe distance of one complete wave cyclemaximum displacement in a longituinal wavemaximum displacement in a longitudinal wavemoves the medium parallel to the wave motionnumber of waves or vibrations produced per second...

Reconstruction 2025-04-11

10 Items: 1st black u.s senetorThe period after the civil warA office to help former slavesAmendment that abolished slaveryThe president who abolished slaveryGranted voting rights to African AmericansLaws that limited the freedom of former slavesA railroad that encouraged settlement to the westAmendment that granted citizenship to former slaves...

GPT 2023-12-14

20 Items: Lacking energy; sluggishIn excellent order; satisfactoryWicked, criminal, or evil in natureIn its original condition; unspoiledPleasingly smooth and musical to hearA harsh, discordant mixture of soundsPresent, appearing, or found everywhereLasting for a very short time; transientExtremely happy, peaceful, or picturesque...

el condicional 2025-03-28

17 Items: she would saywe would come latethe shirt would fitwe would be doctorshe would be a lawyerthey would eat pizzayou would want a jobthey would have to goyou would do homeworkyou would play soccerthe girls would danceI would tell the truthI would get a b (sacar)I would know the answerwe would go to the beachthey would come to school...

Law Of The Chain and Law Of The Catalyst Word Search 2025-11-25

41 Items: TEAMTRUSTDRIVESKILLCHAINGROWTHENERGYACTIONVISIONIMPACTSUPPORTPASSIONWEAKNESSSTRENGTHMOMENTUMCATALYSTSACRIFICEAWARENESSCHARACTERINFLUENCEOWNERSHIPCOMMITMENTDISCIPLINEINITIATIVECREATIVITYMOTIVATIONENGAGEMENTLEADERSHIPINNOVATIONCONSISTENCYIMPROVEMENTRELIABILITYPERFORMANCEEMPOWERMENTPROACTIVITYINSPIRATIONCONTRIBUTIONDEPENDABILITYDETERMINATION...

Nonfiction 2023-10-13

17 Items: topicessaysjournalsnonfictionstatementscommunicationA small eventCan be proved true.Written by that person.Records of daily eventsWritten by someone else.From one person to another.Order or sequence of events.One asks the other questionsPersonal beliefs; cannot be proved.Meant to explain, persuade, or informDiagrams, maps, charts, and photographs.

My favorite cartoons 2026-01-30

15 Items: BenAKU!!!CODENAMEShocker!!Going ghostFootball headVirgil hawkinsReturn the slabEmily ElizabethGot to catch em allLives in a fish/bonethey protect Megakat cityone two three for go!____!I have been denied my revengewinter spring summer and fall

Look Up Verses and Find the Names in the Word Search 2025-12-01

31 Items: EveZionAdamLordTitusMosesAaronSarahJacobNightDavidElijahIsraelChristReubenSamsonSamuelSharonEstherSilentHolyOneAbrahamAhimaazMicaiahPharoahGoliathManassehSadduceesAhasuerusMelchizedekSheshbazzar

Unit 6 Vocab 2025-01-13

15 Items: a region of landto add a territory to a countrya person/groups impact on future generationsA person who moves from one country to anotherThe art of conducting negations with other countriesLand grant made by Mexican government used for farmingSystem for bringing water to farmland by artificial means...

GEP 9B Emotions 2025-10-07

11 Items: DownGuttedShockedThrilledDelightedHorrifiedDevastatedGobsmackedOverwhelmedThe feeling of being confusedThe feeling of being very tired

Folliculogenesis Word Search 2025-09-05

19 Items: astral follicles are...gamete formation in femalesfollicles that have theca cellswhat happens if FSH < thresholdmonthly ovulatory cycles aka...process of forming mature gametesfollicle that is ready for ovulationif FSH> threshold the follicles are......cells convert androgens to oestrogens...sperm cells are known as spermatogonia...

Showgirl 2025-10-28

12 Items: WoodHoneyOpaliteWi$h Li$tCancelledFather FigureEldest DaughterElizabeth TaylorActually RomanticThe Fate of OpheliaRuin the FriendshipThe Life of a Showgirl

The Secret Garden pgs. 89-95 2023-10-11

15 Items: He was ______ with live.What did Colin stop doing?What did Colin start to do?Whose arms did Colin run into?Where did Archibald go to find Colin?No other people are _______ to go near.What season did the garden change again?Where did Colin sit under with his father?How long has nobody been in the garden for?...

Fifth Year - Lesson 4 2024-11-14

15 Items: To cut in two.A very strong wind.A total lack of hope.To make or become worse.A way of acting or behaving.To leave; to go away from a place.To bring back into use or fashion.Without mistakes or errors in facts.A feeling of expression or great joy.A longing for a certain time in the past.The place to which something or someone is going....

HAHA 2023-03-09

17 Items: me!he_is-eli&bro(and=read%like*eli'scute~hello@te-he#named)lennox$lennoxśbrother^amazing+

Group 2: 3rd and 5th grade #2 2020-03-30

12 Items: BEWEHEANDSEEYOUARELOOKGIRLWANTHAVEWHERE

GIDDY FEELINGS 2022-09-07

13 Items: tomymyyouseeeyeandareyoursightcaughtcolorsfavorite

high frequency words 2024-08-23

12 Items: amanbeallandbigcandayawaycomeaboutabove

Grade 3 ELD- Unit 4, Week 1 2025-01-07

12 Items: noisonebighasforyouandplayjumpwithlittle

Differences Word Search 2025-02-11

12 Items: AreAndCodeYourThereMorseBetweenTappingMissionMessagesTranslateDifferences

Ice fishing 2025 2025-01-12

12 Items: AndCodeYourExistMorseBetweenTappingMissionMessagesTranslateDifferencesCommunication

Fry Sight Words (1st 100) 2025-02-22

12 Items: atifandfordowneachpartthatyourfirstwaterwhich

Hello Word Search 2025-05-13

13 Items: i1myisandtwoandnameeviehavebroshellosisters

Brojevni sustavi i logički sklopovi 2025-06-04

12 Items: ANDdvanulebazazapissustavbinarnidekadskinegacijapotencijakonjukcijaheksadekadski

Genesis 1:31 2025-11-12

12 Items: HEITGODSAWALLHADANDWASTHATMADEVERYGOOD

List A, Group 1 2026-01-27

12 Items: andbackcomedownhavehelpherelikemakesaidthiswant

Fibres- fabrics 2023-05-09

16 Items: andallarespunintoyamsmakesilkformknownfibreslengthsproduceman-madefilamentscontinuous

Knights Word Search 2023-03-16

16 Items: knightsennemieking athurour teachertutor of K-Acomedy troupethe round tablelady of the lakehome of king arthursword of king arthurfather of king arthurennemie of king arthurapprentice to a knightthe act of crowning a kinga case of sheath for a swordthe ideal qualities of knighthood

Wordsearch - Imagery - Words to Describe Unpleasant Sounds 2025-07-29

6 Items: (noun) - a harsh, discordant mixture of sounds (EUPHONY or CACOPHONY)(adjective) - making an uproar or loud, confused noise (IRENIC or TUMULTUOUS)(adjective) - loud and insistent cries especially of protest (SERENE or VOCIFEROUS)(adjective) – harsh and jarring because of a lack of harmony (DISCORDANT or MELLIFLUOUS)...

the Quiet reign 2026-01-26

13 Items: who you are.what you are with me .the thing you crave the most.what you do when we are together.what you will always have from me.what you use the most in your body.what anyone you love does not question.the thing you are beneath the aggression.what you see when you look at those you love.what you feel when you hear your own laughter....

Business Word Search 2025-02-18

10 Items: a type of businessnot able to be relied upon.extremely competent in a jobintended to mislead or cheat.not showing a proper sense of responsibility.A person's regular occupation, profession, or trade.having or showing intense and eager enjoyment, interest, or approval.a way of speaking or writing that is precise, elevated, and impersonal...

Quarter 3 Vocab Review Part 2 2025-03-13

10 Items: extremely tiring and demandingto move or act slowly; to delayconfused and slightly worried; puzzleda large or excessive amount of somethingto match or surpass; typically by imitationto gather information or material bit by bitto give new energy to or restore back to a former conditionto move toward the same point and come closer together or meet...

bands 2025-10-24

25 Items: MeSaltlushfireBellyMetalavailnastyFerrisHelmetJawboxThreatFugazibrainssteadythe DayThievesWarningMastodonBaronessshoegazemudhoneyJawbreakeraurorawaveWater Music

The Frog and the Butter 2025-08-22

6 Items: milkkickfrogstandbutterbucket