4th of july Word Searches

Beginning of the School Year 2024-08-14

15 Items: FunArtMathPencilsTeacherFriendsLibraryBackpackHomeworkLunchboxScheduleLearningClassroomNotebooksPlayground

Way of the Warrior Kid 2024-09-15

15 Items: MarcJakeKennySquatsPullupsPushupsHealthyJiuJitsuSwimmingLearningStudyingStopwatchDisciplineConfidenceFlashcards

Aboriginal Peoples of the Arctic  2014-03-21

15 Items: BayPolarSledsBaffinCopperHudsonKayaksIgloosCaribouIglulikClimateLabradorNetsilikMackenzieSadlermiut

Classification and States of Matter 2024-09-27

15 Items: atomheatelementcompoundpressuremoleculesubstancetemperaturevaporizationkineticenergythermalenergypotentialenergychemicalformulathermalexpansionthermalcontraction

25 Days of Peak Wordsearch 2024-10-22

15 Items: SiteFlexFreshSmileFieldGlobalLaunchStationResultsShoppingDeliveryOutboundLogisticsTransportFulfillment

ch. 12 2024-10-21

24 Items: NormsRulesJigsawDiffusionStructureDebriefingViewpointsTeam-rolesCollaborationTask-structureCrystallizationCentering-behaviorLiterature-circlesProsocial-behaviorDistancing-behaviorTask-specializationActive-uninvolvementCooperative-learningPassive-uninvolvementStages-of-group-developmentTeam-assisted-individualization...

U3+U5 Pop2 2023-07-19

19 Items: weakpianomoneysnacksEnglishthe rooman alarmexerciseone's dogfast foodthe guitarthe dishesfor schoolvegetablesthe internetto bed earlyout of moneycomputer gameshousehold chores

IB History Command Terms 2023-05-02

6 Items: Weigh the limitations and strengthsProvide similarities and differencesConsider the merits of a concept/argumentOffer a balanced range of arguments and/or factorsConsider an argument by uncovering interrelationshipsBreak down in order to bring out elements or structure

Cat Word Search 2024-09-12

5 Items: when the data is usedthe state of being free from danger or threat.SSLcertificatetype of malicious software designed to block access to a computer system until a sum of money is paid.software that is specifically designed to disrupt, damage, or gain unauthorized access to a computer system....

Just a bit of fun.. 2013-05-22

15 Items: CBTUNIXHMRCQuizAspireDegreeFujitsuWindowsCafeVIKCollegeLearningFinestraMicrosoftApprenticeUniversity

Settlement of the Oregon Territory  2014-04-03

15 Items: goldwagonmormonmissouriemigrantsexpansionjamespolkcompromisefurtraderswillametteoregontrailmissionariesjosephfremontfiftyfourfortytranscontinentaltreaty

CULTURAL CITIES OF THE WORLD 2020-02-20

15 Items: ROMEPARISMILANOSAKAMIAMIPRAGUELONDONMADRIDMUNICHDUBLINVIENNATORONTOBARCELONAAMSTERDAMJERUSALEM

BRANDS OF WATCHES IN INDIA 2020-02-26

15 Items: RADOTITANTIMEXCASIOFOSSILDIESELMAXIMATISSOTARMANIFASTRACKGIORDANOTAGHEUERDANIELKLEINCITIZENWATCHTOMMYHILFIGER

War of the Worlds 2 2020-04-22

15 Items: WARNICKCLASHPRETTYORGERSJOHNNYWORLDSROOKIESSPEAKERDISCORDVETERANSTRIBUNALCHALLENGENOMINATIONSELIMINATION

Land of the Midnight Sun 2022-12-22

15 Items: goldlakesnaturemuskoxsceneryexploreklondikeiditarodseaotterreindeeradventurebaldeaglewildernessgrizzlybearnorthernlights

December Word of the Day 2023-01-04

15 Items: dyadsoughmizzlelissomenostrumwrithennimietypolyglotappositeephemeraatemporalexpiscatescrutatorxerophyteingeminate

Animals of the Amazon Rainforest 2023-02-15

15 Items: botoonçaararatucanoporaquêcapivarapreguiçatamanduáanacondapeixe-boimacaco-aranhatubarão-touropiranha-vermelhamico-leão-douradorã-dardo-venenosa

Flow of Energy in Ecosystems 2023-05-01

15 Items: atomenergyaquaticfoodwebconsumerorganismproducercarnivoreecosystemnutrientsdecomposermattercycleterrestrialtrophiclevelenergytransfer

Monsters of Myths and Legend 2023-06-20

15 Items: You're after his lucky charms.West Virginia's beloved monster.Stone by day, warriors by night.The terror of sailors the world over.Friend to talking donkeys. Has layers.I hope you brought silver tipped bullets.Bigfoot's frosty cousin in the Himalayas.Garlic and crucifixes will ward these away.This is what you'd classify Frankenstein's monster as....

Authors of wisconsin's challenged books 2023-09-12

15 Items: eliwallallengreennivensaenzbelgealexiepetrushopkinsthompsonvaidmenonwesterfeldmccaffertysilverberg

Healthy Food Of Jennifer Lopez 2023-09-12

15 Items: kaleyamsspinachtunafishbroccoliricebreadeggwhitesbrownriceraspberriescauliflowergreekyogurtstrawberrieschickenbreastsweetpotatoeswhitemeatturkey

In Celebration of Our Ancestors 2023-09-22

15 Items: treenamelinktracebirthrootsfamilyrecordsstoriesrelativemarriageheritagegeneologydescendentphotographs

History of Film Word Search 2024-01-11

15 Items: frameslumierezoetropeanimationblackmariastopmotionthaumatropekinetoscopekinetographtraditionalmagiclanternthomasedisonfantasmagoriecinematographeeadweardmuybridge

Lesson 5: Son of Promise 2024-04-05

15 Items: timesouljewscityisaacbibleangelsin ageishmaelhebrewscovenantin tentslaughtersalvationconclusion

Witch of Blackbird Pond #2 2024-04-26

15 Items: primerquakermasquedecorumgnarledhaplesspriggishsparselyallottedconjuredfiligreeingeniouscordiallywayfarersunorthodox

The Parable of the Pearl 2024-07-26

15 Items: manonesoldwentgreatpriceagainheavengoodlypearlsboughtkingdomseekingmatthewmerchant

Guess the characters of genshin 2024-07-31

15 Items: mimihutaokavehyelanchildekazuhafurinapaimonbarbarabennettrosaliazhonglixianlingtighnariscaramouche

The Second Article of Faith 2024-08-31

16 Items: WEBEMENFOROWNANDNOTFORTHATWILLSINSTHEIRADAMSBELIEVEPUNISHEDTRANSGRESSION

The Outsiders 2022-10-21

13 Items: RoughCool/SharpPet of the groupRich pack unloyalSmiles a lot and shopliftsModel like Ponyboys brotherQuite more ditsy than cherryGood looking fiery cheerleaderwe’re both greasers and socs hang outIndependent impulsive lacks common sense honestHigh cheek bones very blonde hair blazing blue eyes17 Sodapops best friend y’all and lean thick greasy hair...

Christmas 2023-12-11

7 Items: what does santa bring you?what do you build a snowman out of?what is rudophs favourite vegetable?what goes on top of the christmas treewhat meat do you have on christmas day?what is a traditional christmas desert?where does santa put your presents under

BT2A 6.3 Prepositions of Motion 2023-09-14

9 Items: downoveraroundout ofthroughup (3 words)into (3 words)from (5 letter word)toward (5 letter word)

Sound Word Search 2022-12-13

11 Items: moving back and forththe absence of matterthe way a wave travelshow high or low a sound iswhat sound waves travel throughwave the type of wave a sound isalso known as longitudinal wavesthe ability for something to do workwhen air particles are furthest apartwhen air particles are close togethervibrations create this so you can hear it

Success Word Search 2023-02-10

10 Items: HAPPYREALITYSPRINGSIRISH PUBPINK CANDYI MISS YOUCUTEST TEETHPRAISE THE ___THE JACKSONVILLE...THIS YEAR WILL BE FULL OF

Employability Skills 2024-10-21

12 Items: style of speaking or behavingspecific style of behavior in the workplaceworking effectively and efficiently with othersvalues or standards which direct the way individuals interact with othersability to motivate people to accomplish a better result for an organization...

Unit 9 2024-01-10

12 Items: fasttwinlooseguessvotesto valuea suddenthoughtfulnot correctto make calmto make fun ofthe area near a place

Connor Moore 2024-05-16

15 Items: makes up everythingthe molecular substancenumber 22 periodic tablenumber 1 in the periodic tablenumber 6 in the periodic tablenumber 3 in the periodic tablenumber 26 in the periodic tablenumber 11 in the periodic tablenumber 80 in the periodic tablenumber 20 in the periodic tablenumber 12 in the periodic tablenumber 47 in the periodic table...

happy saturday 2024-08-17

14 Items: champagne brutrocca delle maciemarques de caceresstill bottled waterbanquet space on 9th floorexecutive chef of tre rivaliprickly pear, lime, ginger beerchariman and ceo of first pathwayarborio rice, bolognese, nonna's saucewest coast ipa + mango dragonfruit sourfire roasted eggplant, tahini, roasted pepper...

4th Our Dual Language Class - Nuestra Clase Dual Print Share Edit Answers 2024-08-13

18 Items: AnaYramHaleyThiagoArthurSalomeAdalynOliverMathiasNathalyJesslynRafaelaAllisonEnriqueRafeliaSavannahCatalinaDaniella

Unit 3 2023-09-16

12 Items: Filled up withTo use up; wasteTo confuse and frustrateTo put into action; executeTo get in the way of, hinderTo not do something; refrainStubbornly persistent; determinedA group that attends an important personTo stop one from doing something; preventTo support for an extended period of timeTo fill up from within; to spread throughout...

The Respiratory System 2024-04-24

12 Items: What we breath outHas 12 paired bonesThe smallest airwayOften called the windwipeWhere you breath in and outAllowes our cells to breath.Major muscle of respiratory systemSomething at the end of bronchiolesA large airway leading from windwipeSomething that always you too breathBlood vessels that exist through out your body...

Unit 3 Word Search Natalie O'Donnell Period 2 2024-09-09

12 Items: Filled up with.To use up; waste.To confuse and frustrate.To put into action; execute.To get in the way of, hinder.To not do something; refrain.Stubbornly persistent; determined.A group that attends an important person.To stop one from doing something; prevent.To support for an extended period of time.To fill up from within; to spread throughout....

Level 3 Chapter 5 Vocabulary 2022-10-13

20 Items: ImprovementTo reach a goalTo no longer tryGreat, fantasticNo longer workingRelated to the bodyRelated to the mindNot the right amountOver the amount neededTo go on a trip/journeyAnother word for achieveWhere a person was raisedA fun activity or journeyNo more of that species leftVery few of that species leftItems needed for a sport or task...

Chemistry MI project 2023-02-16

20 Items: H2ONaClOrganizes elementSymbol H, number 1symbol K, number 19symbol S, number 16Symbol Fe, Number 26symbol Ca, number 20Symbol Ti, number 22symbol Co, number 27symbol Ag, number 47symbol Zn, number 30symbol Kr, number 36What atoms want to beLiquid, atomic symbol Br,Bond between metal and nonmetalAmount of protons in an element...

EOG Review Words 2024-05-06

99 Items: ideaciteclueideaplotpoemtoneclaimdramadrawnrhymescenesoundstorystylethemetraceactionaspectassessauthorconveydetaildiffersimileimpactstanzapropelrevealchoiceanalogyanalyzecaptionclarifycompareexplainopinionof viewprovideprovokepurposerespondsettingspeakersummarysupportallusionanalysisargumentaudienceconflictcontrastdescribedialogueevaluateevidence...

FAMOUS CAVES OF THE WORLD 2020-02-17

15 Items: SPYBATUSMOOMAGURABADANJSKOCJANFINGALSKRUBERAFRASASSIBLUEGROTTOWOOKEYHOLELECHUGUILLAHANGSONDOONGGIANTCRYSTALEISRIESENWELT

DRINKS AND BEVERAGES OF INDIA 2020-02-18

15 Items: LASSIKANJICHAACHOOKALINANNARIAAMPANHASHIKANJIJALJEERASOLKADHISAUNFPANIMASALACHAIJIGARTHANDAKHUSSHARBATKOKUMSHARBATTANKAWTORAANI

English Words of Arabic Origin 2020-03-14

15 Items: zerosodacandymummylemonsugarcoffeecottonsafarialgebramascararacquetmattressmagazinealgorithm

Landforms and Bodies of Water 2021-09-23

15 Items: BayHillLakePondPlainCoastOceanRiverValleyCanyonIslandPlateauVolcanoMountainPeninsula

J's word search of Chaos 2022-10-05

15 Items: legdogsandratsbeanscomedyfourtyurmotherviolencecriminalmeltdownpotassiumscoliosiscapitalismconsumption

Properties of the Sun vocab 2023-09-08

15 Items: sunstarorbitcoronarotatesunspotradiationsolarflareprominencephotospherechromospheremainsequencenuclearfissonastronomicalunitdifferentialrotation

Healthy Food Of Jennifer Lopez 2023-09-12

15 Items: kaleyamsspinachtunafishbroccoliricebreadeggwhitesbrownricerasberriescauliflowergreekyogurtstrawberrieschickenbreastsweetpotatoeswhitemeatturkey

The food of the Tudors 2021-02-15

15 Items: ryemintsageswanboardeernionsthymewheatgeeseparsleypeafowlcabbagesrosemarypartridges

Diary Of A Wimpy Kid 2024-03-08

15 Items: penedscurrypoisedvicousbaptistwhizzedbluffingdreadingaluminumslinkinginsolentauthenticdelightedhighwaymanshuffleboard

Books of the Old Testament 2024-04-11

15 Items: ruthkingsjonahsamuelexodusjoshuagenesismalachinumbersobadiahnehemiahjeremiahzechariahleviticusecclesiastes

Books of the New Testament 2024-04-11

15 Items: lukejohnactsjudetituspeterjamesromanshebrewsmatthewphilemongalatiansrevelationcorinthiansthessalonians

Pr3 4C Tailor of Swaffham 2024-05-07

15 Items: oakvoicestolespadecrowdtailorwoodenvillagecottageangrilyhowevertowardspavementstraightsuddenly

Diseases of the Skeletal System 2024-06-28

15 Items: goutpagetricketskyphosislordosisfracturearthritisscoliosisrheumatoidosteoporosisosteosarcomaosteomalaciaosteomyelitisosteonecrosisosteoarthritis

Constitutional Law (Protected vs. Unprotected Speech) 2023-09-22

11 Items: Direct personal insults or offensive language that is likely to provoke a violent reaction, and is not protected by the First Amendment.False statements, spoken or written, that harm the reputation of an individual or entity, potentially leading to legal action for damages....

St Patrick of Ireland (P4) 2014-12-02

15 Items: poperomanbishopDruidssnakesSuccatgospelpatrickirelandbritainshepherdshamrockcelestinemissionaryDownpatrick

St Patrick of Ireland (P3) 2014-12-02

15 Items: PopeRomanbishopDruidssnakesSuccatgospelPatrickIrelandBritainshepherdshamrockCelestinemissionaryDownpatrick

Dundee Hall of Fame I 2019-03-20

15 Items: BoydAllanTroupPirieBrownWrightStuartMcGannGeddesDuncanWilsonDouglasGlennieDonaldsonRobertson

CITIES AND DISTRICTS OF ASSAM 2020-03-13

15 Items: BAKSANAGAONJORHATBARPETADHEMAJIDARRANGGOLAGHATGUWAHATISONITPURMORIGAONKARIMGANJDIBRUGARHSIVASAGARLAKHIMPURBONGAIGAON

CITIES AND DISTRICTS OF ODISHA 2020-03-13

15 Items: PURIJAJPURCUTTACKBHADRAKJEYPOREROURKELABALASOREBARIPADABALANGIRPARADEEPBRAHMAPURSAMBALPURJHARSUGUDABHUBANESHWARBHAWANIPATNA

STREET FOODS OF THE WORLD 2020-03-18

15 Items: BAGELCREPEDIMSUMBURGERHOTDOGPRETZELBURRITOCORNDOGFALAFELDOUGHNUTKATIROLLPANIPURIPAVBHAJIBREADPAKORAFRENCHFRIES

List of Wild Animals 3 2020-05-16

15 Items: ElkFoxBatHareToadFrogDeerMoleOtterBadgerLizardGorillaHedgehogReindeerHippopotamus

Forgiveness and Cleansing of Sins 2020-06-05

15 Items: sinsmarkwashdeathbloodstainforgetoffenseconfesscleansingredemptionforgivenessapplicationaccomplishmentunrighteousness

The Tale of Peter Rabbit 2022-09-11

15 Items: tailbunnypetermopsymotherrabbitflopsygardenonionslettucesradishescabbagesscarecrowmr.mcgregorwheelbarrow

A Little Spot of Christmas 2022-12-11

15 Items: joyspotlovesnowsantahappygiftsgivingfamilyhelpfulfriendskindnesspatiencethankfulchristmas

A little spot of anger 2023-02-13

15 Items: totaptheonenowspotfromfourfillyourwithlovecareangerspots

Parable of the Four Soils 2023-11-25

15 Items: sowseedpathrocksoilcropfarmerthornsplantschokedyieldedkingdomtrampledwitheredscattering

The Era of Thomas Jefferson 2024-01-05

15 Items: tecumsehsacagaweaaaronburrzebulonpikejamesmadisondollymadisonwilliamclarkandrewjacksonwilliammarburystephendecaturfrancisscottkeymeriwetherlewisthomasjeffersonoliverhazardperrywilliamhenryharrison

Revelations of Victory Lesson 3 2024-05-11

15 Items: womanjesusisraeldragonsaintsplaguesbabylonserpentfaithfuljudgementmilleniumarmageddontriumphantfalseprophetgreattribulation

The 21st Night of September 2024-06-22

15 Items: windfirethorearthdiscovinylpartybridegroomtoastgroovyhunterweddingceremonyseptember

Hearts Hall of Fame I 2019-03-20

15 Items: KiddConnFordBusbyWhitePurdieBattlesJardineAndersonCrawfordMarshallColquhounMacDonaldJefferiesCruickshank

Elements of a Short Story  2019-10-29

16 Items: plotmoodtonethemetitlerisingactionclimaxactionfallingsettingconflictantagonistresolutioncharactersprotagonist

TYPES OF SHORT-CUT PASTA 2020-02-28

15 Items: FIORIANELLIKUSKSUGOMITIBOCCOLIFESTONIFUSILLIGEMELLICHIFFERIFARFALLELANTERNECASARECCECAVATAPPIMACCHERONIGARGANELLI

Hibs Hall of Fame II 2019-03-20

15 Items: SwanShawSmithBakerDuncanRennieMcGheeReillyFarmerOrmondStantonTurnbullMcNamaraWhelahanJohnstone

City of Chandler Building Blocks 2024-08-01

15 Items: JOANTUDORTYLERDAISEEHAYDENMAKENAMARIAHYAZMINELIANNAERNESTOGISELLEISSAMARJASMINEVANESSANICHELLE

Azul Word Search 2023-03-02

4 Items: The color of the skyThe opposite of sinnyThe things you wear on your feetWear it on wrist and tells you the time

Production Practice /ɪ/ 2024-10-06

10 Items: A short playTo raise somethingPast tense of "light"Another word for largeTo jump lightly over somethingWhen you fail to notice somethingA number of consecutive items; a to-doTo put something down quickly into liquidA box that usually holds something, usually in first aidWhen a hand or object comes forcefully into contact with something else

Numbers 25/27 Wordsearch 2023-03-10

8 Items: The High Priest was _________The successor of Moses was _________The people Israel were the _________The people Joshua led were the _________The false god Israel worshiped was _________The place Moses did not enter was the ________The desert where Moses sinned was the desert of _________...

computer word search 2023-03-20

8 Items: what isa task called?this stores embedded systemswhat cools the computer down?what do most of the parts lie on?what is the central processing unit?what does arithmetic logic unit stand forwhat is the computers way of multi tasking?this is what received info from the computer is called

Biochem - Diabetic Nephropathy 2024-03-27

8 Items: ERK1/2, p38, JNKConverts ROS to waterType of receptors AT1R and AT2R areConverts angiotensinogen to angiotensin ICytosolic tyrosine kinases that activate STATForm dimers (SIS inducing factor complexes [SIF])Main protein used in the second process of ROS productionProtein normally found in blood, presence in urine indicates kidney problem

Digital Word Search 2023-02-10

6 Items: you can communicate using this.one can get more of this online.devices you can communicate on this.an example of what we use to socialise.you can communicate over long distance using this.digital technology allows you to connect with these people

Have you earned your tomorrow 2024-07-17

10 Items: What is almost over, according to the poem?What is "slipping fast" according to the poem?What informal greeting is mentioned in the poem?What does the poem suggest you might have earnedWhat emotion might someone feel for a deed you did today?What word describes the type of greeting given to a friend?...

Air Word Search 2024-09-25

8 Items: Method used to separate 2 solidsWhen a solid does not dissolve into a liquidSolid that dissolves in water to form a solutionProcess that occurs when a solid transfers into a gas directlyMixture that consists of oxygen, Carbon dioxide, nitrogen, and other gasesSeparates an insoluble solid from a liquid by pouring the liquid in a separate container...

Unit Three 2023-09-17

12 Items: filled up withto use up; wasteto confuse and frustrateto put into action; executeto get in the way of, hinderto not do something; refrainstubbornly persistent; determineda group that attends an important personto stop one from doing something; preventto support for an extended period of timeto fill up from within; to spread throughout...

Water 2023-02-08

13 Items: Plant sweatWater dropletsA lack of waterLiving things on the earthA storm with a violent windA tropical storm but indianThe gases around our planetWhen a liquid turns into a gasA sudden accident thats real badA substance thats suspended in the airA body of rock that transmits groundwaterA storm with a vilent wind except tropical!...

Netherlands 2022-10-31

10 Items: A famous painter.How they say goodbye.A special Dutch food.They love eating cheese.They are all over the Netherlands.Cow, This is where milk comes from.They are know as the national flower.The capital city of of the Netherlands.clogs, They are shoes woren while clog dancing....

trs23 ie2 u5p1 2023-01-12

10 Items: a small, glass ballput it with your keysa kind of scary animala small model of a personuse it to erase your writingput it on your clothes or baguse it to sharpen your penciluse it to colour in a drawingstick it on paper or on your thingsblow it up and it will float in the air

HOW A SPEAKER WORKS 2024-05-03

10 Items: Inside a SPEAKER there is a wire _____________ .What part of the SPEAKER moves when current flows through it?When a _____________ is made, a sound comes from the SPEAKER.What electronic device converts electrical energy into sound?A SPEAKER converts electrical _______________________ into sound....

Minimum Wage Word Search 2024-06-04

10 Items: who proposed the idea of minimum wagelabor law that created the minimum wagewhat group wants to increase minimum wagewhat government is in charge of mandating a minimum wagewho can change the minimum wage based off certain conditionshelps to promote policies that work to help unemployed workers...

QA Scorecard Elements 2024-07-23

10 Items: The name of the Beehive AI bot. (6 letters)A source of information and resources. (13 letters)Something you receive in return for your work. (12 letters)Understanding and sharing the feelings of another. (7 letters)Managing personal information collected from users. (16 letters)What happens behind the scenes in a software system? (14 letters)...

Geography class of period 5, 2013  2013-06-04

34 Items: RaceNormUrbanunionColonyAfricaHungerEconomyHistoryClimateCulturalReligionEuropeanGeographyMigrationPoliticalDiffusionPrejudiceDiversityEthnicityLanguagesSovereignDevelopedPopulationXenophobiaSubculturedevelopingMicro-loanEnterpriseStudentnewsNationalismEntrepreneurEnvironmentalGlobal-warming

Principles of Creativity in the Workplace 2013-12-12

29 Items: funmindplanrisksideasjudgehealthcapturebroadenprocessexplorecouragemapping.failuresworkplacestrengthssetbacks.iterativechallengesreflectingcommunitiesinnovationsconstraintsassumptionsimaginationsurroundingscompetenciescollaborationentertainment

The Entry of Jesus into Jerusalem 2015-03-31

27 Items: GODJOYCOLTKINGLORDPALMROADCROWDENTRYGLORYJESUSPEACEDONKEYHEAVENLEAVESSPREADVOICESBLESSEDHOSANNAPRAISEDSHOUTEDVILLAGEWELCOMECLOTHINGMIRACLESDISCIPLESJERUSALEM

297 Books of the New Testament 2015-05-28

20 Items: MarkLukeJohnActsJudeTitusJamesPeterRomansMatthewTimothyHebrewsPhilemonGalatiansEphesiansColossiansRevelationCorinthiansPhilippiansThessalonians

Ms Sutej's Class of 2015-2016 2015-08-11

60 Items: LukeColeNoahElleMikaMannKateNetoReidWeirBerniBiggsLoganDreesDylanDavidSarahAngieAidanRicciDSilvaFavellJustinAleksaHunterSierraInacioLeavoySerenaNicoleOBrienDanielOrazemConradDeclanReillyMarcusBekerisMattiasNatalieFlemingMarleneKilleenMartiniWilliamTatianaBlakemanCimermanIsabellaMadelineMacalinoMarchandNicholasPietrzakGucciardiMacdonaldMackenzie...

My Rows and Piles of Coins 2015-09-30

20 Items: hourproudavoidprowlannoybroilshoweramountvoyagechoiceemploybouncepoisoncowardappointhoweverturmoilchowderthousandmountain

names of the States, part 2 2016-12-29

24 Items: IowaAlaskaKansasArizonaMontanaVermontColoradoIllinoisMarylandNebraskaOklahomaLouisianaMinnesotaNewMexicoTennesseeCaliforniaWashingtonMississippiNorthDakotaSouthDakotaNewHampshirePennsylvaniaMassachusettsSouthCarolina