4th of july Word Searches

weather lexicon 2024-02-27

14 Items: stormand thunderand lightningwhat the wind doesyou can slip on ita synonym of humidan infinit(iv)e Elsathe curtain of the skyJack, one of the guardianswhat Olaf's body is made of~, ~, go away come again another dayleather shoes, when they are like the sunGone with the ... (Hollywood blockbuster)it can be thick or thin, when it disappears it lifts

bible 2020-02-29

20 Items: OFGODTHEARKNOTMOSTHIGHDOVELAKEFIRETHOUMOSESJESUSSHALTCOVETISRAELPRAISEKINGDOMANIMALSBLESSING

Gulf of Mexico 2021-05-28

21 Items: ofofredseaGulfJessTexasHotubMexicoAlonsosnapperturtlesAlabamaFloridacurrentJeffreyDespairfounderAlwarezLouisianaMississippi

Article of Faith #3 2025-03-01

23 Items: WeofbebytooftheallmaytheandthethatlawssavedChristGospelbelievethroughmankindAtonementobedienceordinances

List 10-14 circle 2025-05-08

20 Items: onofbedoupbighiswasgotarenotlothadtenbutgoodveryherelookwant

DAILY PUZZLE 9.3.25 NATIONAL SKYSCRAPER DAY 2025-09-02

21 Items: OfOnetallParkBankTowerSpaceStateWorldTradeWillisNeedleEmpireCenterCenterSeattleCentralAmericaHancockbuildingsskyscraper

Kaki 2025-11-24

20 Items: asisofonearetwofromgoesknowbeendoeshavemanyNinaaboutagaincouldHunterbecauseHarrison

Lesson 1 Find-a-word 2026-02-26

20 Items: inofwhohimhissinsnameJohnBibleJesusPsalmsRomansthroughGenesisMatthewEveryonebelievesreceivesScriptureforgiveness

List 34 2026-05-06

20 Items: ofwhowhyhowwhatwhentheyfromhaveneedthuswherewomanwomenyoungitselfalwaysexpectinspectsomething

Technology Vocabulary 2026-04-07

9 Items: correcting somethingname a name of a filea secret word or phrasea global computer networkvisual selection of somethinga series of interconnected devicesa series of programmed instructionsa popular graphical operating systemapplication used to analyze, organize and store data

Year 4 Words, WordsSearch 2024-11-21

20 Items: MinuteBelieveregularPromiseQuarterStrangeCalendarProbablyPossibleQuestionStraight- Clean clothes- Known by many people- the month after January- When you know a lot of things- what you call your fanourite thing- when you don't give up on something- A peice of land , that lives on water- The thing that makes sick people get better...

Spanish 2025-10-09

33 Items: Pendaybookdeskyearweekmonthtodaymarchaprilfolderpencilmondayfridaysundaystudentstudentteacherteachertuesdayjanuarynotebooktomorrowthursdaysaturdayfebruaryclassroomwednesdaysheet of paperits the.. of..what is the datewhat day is todayits the first of...

vocab man 2026-02-25

32 Items: inofmyyoutheflagdeskdoorheresomemouseclocktablechairtherewhereposterscreenwindowbehindnext tocomputerbackpackkeyboardthere istrash canon top ofunderneathin front ofun(a) its awhat is thispencil sharpener

Carts, Ladders, & Pedestrians 2023-03-31

37 Items: flatFeetpushpullblueCartwireZonecanoeglassClimbLadderLadderstablebrokentuggerPickermutualof WaydriverorangeContactdamagedutilityContactwalkwaybracketspositiontransferspreadersoverreachcrosswalkof ServicepedestrianrestrictedCart Ladderintersection

Preposiciones 2025-09-28

20 Items: inherenearwiththerebelowmiddlecenterbehindinsidewithoutfar fromon, overtogetheron top ofbackroundDown,belowover therein front ofbetween, among

ALGEBRA 2026-05-01

38 Items: addcubicrootsvertexfactordividelinearalgebraformulastandardmultiplesubtractbinomialgroupingradicalsintegersgraphingverticalparallelmononimaltrinomialexponentsequationsquadraticspolynomialhorizontalsquare-rootx-intercepty-interceptpoint-slopediscriminantcoefficientsslope-formulaperpendicularabsolute-valueslope-interceptaxis-of-symmetry...

Five Oceans Word Search 2024-08-29

13 Items: Triangular shaped oceanLargest of the five oceansDeepest point in the oceanSmallest of the five oceansThe Titanic sank in this oceanWas recognized as an ocean in 2000Warm vents formed in volcanic areasHeavy rainstorms that happen in South AsiaThick layer of fat that keeps mammals warmLarge chunk of ice that broke off a glacier...

Pyramids Word Search 2026-04-14

13 Items: Traveling regularlyThese traders acted as spiesMassive, terraced, stone templesThe original natives of a regionThe capital city of the Aztec EmpireA natural lake in the valley of mexicoSpanish explorers led by Hernan Cortes​The watering of land by artificial meansCreated by the Aztec Empire and creates music...

July 25 Word Search -- Travel Related Words 2024-07-21

12 Items: crewfaredelaypilotflightrunwayticketairportbaggagecaptainairplanetraveler

MMIC Handling Training 2025-04-10

15 Items: A line around the border of a componentWhat type of pack does NOT get filler paper?What position should you open a waffle pack in?Another word for die. The more commonly heard word.Before _____ a waffle pack, gently tap on the top surfaceA vacuum chuck is used to remove die from what style gel pack?...

Ancient Rome 2026-05-21

15 Items: - Clue: The supreme ruler of the Roman Empire.- Clue: An ordinary, working-class citizen in ancient Rome.- Clue: The historical language spoken by the ancient Romans.- Clue: A distinctive draped garment worn by citizens of ancient Rome.- Clue: A member of the noble or wealthy ruling class in ancient Rome....

26411 2026-03-01

16 Items: This can render a splice useless.Two or more conductors joined together.One of the five basic steps to rebuild a splice.This stranding has the smallest overall diameterA terminator for high voltage circuit conductors.A conductive barrier against electromagnetic fields.When air breaks down it creates this type of discharge....

Functions of parts of the body 2026-04-09

20 Items: seerunjumpclapwalktossbitewavekickbendpullblowheardancesmellstompmunchsmelllistenbreathe

Word Search 2025-01-08

30 Items: Related to the sunThe planet we live onEarth’s natural satelliteA being from another worldThe sky above us after sunsetThe closest planet to the sunA ball of glowing gas in spaceA large object orbiting a starThe start of a rocket’s flightAn object that orbits a planetThe fourth planet from the sunA vehicle used for space travel...

VOCABULARY UNIT 1 - INTERESTS 2025-02-21

21 Items: SportsGeneral Interests- Physical activities involving skill and competition.- A winter sport involving sliding on snow using skis.- A sport where players roll a ball to knock down pins.- Popular styles of clothing, accessories, or appearance.- Activities or subjects that someone enjoys or finds engaging....

End of Year Math Vocabulary 2025-04-21

25 Items: equal in measurethe distance around a figurelongest side of right triangle"flips" a figure over a given linerepresents constant rate of changeangles that are in matching cornersvolume is 4/3 pi times radius cubed"slides" a figure to a new locationline that intersects 2 parallel linesthe number of square units in a figure...

Firstaid Word Search 2025-04-17

18 Items: - Heavy, uncontrollable bleeding- The sudden stoppage of the heart- Damp, soft, sticky, and unusually cool- A snug bandage used to control bleeding- ointment and bandages applied to the wound- A reduction of blood flow to a part of the brain- Approval for what is to be done or proposed by another...

Summer 2025-09-12

20 Items: julide zonreizenfietsenzwemmenaugustusde bijenkamperenhet ijsjehet zweethet strandde hangmatzonnebadende schaduwde barbecuede vakantiede lemonadehet zwembadde vakantiede zonnebrand

PR 1 spelling 1 2018-05-27

52 Items: IboycatdogeggjaronepensixtwozoobookdoorfivegirlJulykingkneeleftninerainwalkappleeighthouseheartmousequeenquietrightseventablevowelx-rayzebraAugustcastleFridaygroundIndianMondaypurpleviolinwindowyellowoctopusladybirdNovemberumbrellaxylophoneyesterdayuniversity

6th Grade Lesson 1-4 Word Search 2023-05-10

46 Items: maydrawbakestarbusyjunejulyfirstthirdfifthsixthgradefloorpilotmodelskatespeakmarchaprilsecondfourthtravelplayersingerfutureaugustteacherfishingcampingjanuaryoctoberdesignerchildrenclimbingshoppingswimmingfebruarynovemberdecemberclassroomscientistdeliciousafternoonseptemberelementaryphotographer

SUMMER SHENANIGANS! 2026-06-08

52 Items: POOLSANDJUNEJULYBOATOCEANTOWELGRILLWAVESPICNICSMORESBURGERRESORTCOOLERCAMPINGHOTDOGSSUNBURNHAMMOCKFISHINGSUNSHINESWIMSUITCHLORINECAMPFIREBASEBALLSWIMMINGHUMIDITYPOPSICLEICECREAMSNOWCONELEMONADEBARBECUEROADTRIPVACATIONBEACHBALLSURFBOARDFLIPFLOPSSUNSCREENFIREWORKSSPRINKLERLIFEGUARDWATERPARKSLIPNSLIDEJULYFOURTHSUNGLASSESSANDCASTLEWATERMELONMOSQUITOES...

Victoria & Cory 2025-02-07

24 Items: Who is loudestWho is funnierCory's eye colorTheir dog's nameCory's alma materCory's middle nameWhat Cory collectsVictoria's eye colorCity they got engagedVictoria's alma materVictoria's middle nameTheir favorite TV showCory's favorite animalWho is a better driverWho wins all board gamesRestaurant of first dateAstrological sign of both...

Exponent  2018-05-29

13 Items: ofindexpowerrootsgraphordersquaredecimalExponentequationorderpairoperationexpression

Falling Word Search 2023-10-05

13 Items: isofupyougetandpartonlywhenkeepgoingfallinggrowing

N/A 2026-01-07

13 Items: ofnoseknowscoastgrandheartwheelenemytypingcenturypresentbeautifulmisfortune

sight word 1 2026-03-26

13 Items: aoftoinisittheandyouthatMsromerorainbowringkindergarten

Solar Energy 2026-03-31

14 Items: Which part of the solar spectrum is felt as heat?Which part of the solar spectrum causes sunburns?What does the "C" stand for in CSP (Solar Power)?What is the horizontal angle of the sun's position?What is the power per unit area received from the sun?What is the process of a solar cell taking in light energy?...

Easter 2026-04-04

17 Items: Represents the Last SupperThese held Jesus to the crossThe color of the burial clothsWhat Jesus won over death and sinThe color of the robe put on JesusWhat the women brought to the tombWhat Jesus carried through the streetsSoldiers used this to give Jesus vinegarWhat the angels said had happened to JesusWhat the soldier used to pierce Jesus's side...

Las actividades extraescolares 2023-06-14

17 Items: chesslast yearlast termphotographylast summera tournamenta competitionI won a trophymore confidenceI played a solomake new friendsdevelop your talentsen I participated ina sense of achievementfor (a length of time)forget the pressures of schoolthe opportunity to express yourself

Phospholipids Word Search 2025-01-27

36 Items: What is a term for “water-loving”?What is a term for “water-hating”?What does passive transport not require?How do phospholipids arrange in cell membranes?Is diffusion a spontaneous or nonspontaneous process?Membrane protein that spans across the lipid bilayer.What is the most abundant lipid in cellular membranes?...

Spanish Vocab 2 2023-02-22

55 Items: inpendayMayyearJulyJunebookweekAprilMarchmonthAugustfolderSundayseasonwinterFridaypencilMondaypleasespringsummerFridayJanuaryTuesdayOctobernotebookhow manyDecemberFebruaryIt`s hottomorrowNovemberSaturdayIt`s coldWednesdayclassroomSeptemberIt`s sunnyIt`s windyfall/autumnIt`s rainingIt`s snowingstudent deskteacher(male)(male) studentteacher(female)...

WORDSEARCH 2025-12-04

10 Items: locationa yellow oregrows on treename of a manmilitary overseascrossed over borderstronger than metaltook action after waropposite of confederateaction to get rid of slavery

Competitors Companion Word Search - July week 3 2013-07-28

12 Items: MaryAnneJohnHenryGeorgeEdwardStephenCharlesRichardWilliamVictoriaElizabeth

Class VII Water 2025-03-30

15 Items: The sun’s heat causes evaporation of water into vapour.When the water vapour cools down, it condenses and forms clouds.Oceans contain 97.3% of the total water on Earth, which is mostly salty.The rhythmic rise and fall of ocean water twice in a day is called tide.The major sources of fresh water are rivers, ponds, springs and glaciers....

G7 WWI Vocabulary from The Great War Dr. E 2025-01-15

13 Items: EasternFrontA formal agreement of peace or trade between countriesThe murder of someone for political reasons, often a political leaderAn agreement made by opposing sides in a war to stop fighting for a certain time; a truce.Also known as the Central Empires or the Quadruple Alliance (Germany, Austro-Hungarian Empire,...

unit 3.2 2024-11-14

8 Items: is a group of people who are representative of the target marketis the process of gathering, analysing and interpreting information about a marketis when people are selected at random as a source of information for market researchinvolve asking individuals a series of questions, often face-to-face or over the phone...

Prefixes and Suffixes 1 2025-03-18

26 Items: onetwomanyfourafterthreeagainagainstwithoutfear oftogetherstudy ofnot, noneable to beunder, belowa person whoround, aroundamong, betweenwithin, insideacross, throughbad, wrong, illbefore, in advanceunder, below, lessover, beyond, highabove, beyond, overstate or quality of

Word Search 2026-02-02

25 Items: The making of productsColonial New York industryWrote the Albany Plan of UnionAnother colonial New York industryFirst British governor of the colonyReason French Huguenots came to New YorkLarge estates where most colonists livedCountry that won the French and Indian WarLargest trading center in colonial New York...

Key Terms-Topic 9 2024-05-22

15 Items: exclusive control by one company over an entire industry1886 labor-related protest in Chicago which ended in deadly violence1890 law banning any trust that restrained interstate trade or commercesociety in which people of different nationalities assimilate to form one culture...

Hatcho Elementary School 2025-10-05

15 Items: What animal is Mr. Tomono afraid of?The groups made from all grades are called what?What disaster experience did you do in 4th grade?What is the name of the 5th grade English textbook?What sport did the 5th graders practice in PE class?What famous Toyohashi food did you make in 3rd grade?Teachers read books to students during Story __________....

Unit 7 2014-10-27

12 Items: ofinhowwhydidsitsixbigsomemakewillanimal

Gold M100W 2017-08-12

12 Items: aIbeinisitoftoandthewasthat

Puzzle #3 3rd-5th grade 2020-04-15

12 Items: DOOFFORHASPUTSHECOMEGOODGIVEHEREWITHCANNOT

First Grade List 6 2022-10-24

12 Items: ofyoucuffpuffwillwellbelldollstuffsniffcrossbless

Judah's word search 2022-11-03

12 Items: ofdoshyshethisthatthenwithshadesheepbrushfresh

027 2023-11-15

12 Items: ofbytofordayridenextweekyearwithdrivebicycle

words 2024-08-25

14 Items: inonitisinifofonoutinkiceilloffunder

Jump Out Words 2025-05-30

12 Items: ofittobeasattheandyouforarewas

Sight Words-Week of Sept. 29 2025-09-27

12 Items: ofweusgetdayputshehelpfromgoodworkvery

The Word Search 2025-10-20

12 Items: oftoinisithetheyouandforwasthat

Of Word Search 2025-11-01

12 Items: ofifnoitheongotheareandyesthat

Shy Word Search 2025-11-04

12 Items: ofdoshyshethisthatthenwithshadesheepbrushfresh

Spelling List 8 2025-11-14

12 Items: ofdoshyshethisthatthenwithshadesheepbrushfresh

Sight Words 1 2026-04-08

12 Items: asofallnotshearegotnowsithadgirlthen

High Frequency Words 2026-05-22

12 Items: meofhashaveherelikeplaythistheywalkwhatwhere

Word Wizards 2026-05-26

12 Items: ofedgelovefudgehedgeledgejudgeeightcoverbridgebadgerfridge

Reconstruction 2026-02-17

19 Items: 40 acres and a __The fancy term for bills becoming lawThe biggest cash crop produced by the southSomeone who fought for the banning of slaveryThe system of separating black spaces and white spacesAndrew who became president after Lincoln was assassinatedThe economy of the south was built on this prior to the civil war...

Identity 2026-02-03

8 Items: The largest race in Singapore.History shared by a group of people.The biggest religious group in Singapore.The Muslims worship their God at this place.Shared practices and traditions of a group of people.The group of people I live with who can shape my identity.A religion that has the belief that God can take on three forms....

Patriot Day Word Search 2025-09-10

30 Items: Which building was taller?(2 words)The 9/11 Memorial has _____ memorial pools.September 11 is known as a Day of _________.The 9/11 Memorial pools are ____ _____ deep.The name of the location struck on 9/11.(3 words)The city where the one non-military plane flew to on 9/11.The length of time the fires at Ground Zero burned.(2 words)...

of 2026-04-09

11 Items: ofofofoofforoverfoodfootfoolfordoffer

Jenny & Aldo 2025-05-06

25 Items: Town we live inBride's hometownStreet we live onBride's birth monthFirst date locationBride's middle nameEngagement ring cutMonth Groom proposedLocation of proposalFavorite hockey teamHoneymoon destinationYoungest horse's nameBrand of Groom's truckNumber of fish at homeCouple's favorite sodaGroom's dream dog breedFirst vacation together...

Paige & Jonathan 2025-08-04

25 Items: Knox's hometownGroom's siblingsGroom's hometownBride's hometownBride's professionGroom's professionBride's middle nameGroom's middle nameCouple's dog's nameMaid of Honor's nameTown couple lives inGroom's birthday monthBride's college mascotBride's favorite colorBride's birthday monthGroom's favorite colorMonth Jonathan proposed...

TEST 2026-06-13

20 Items: passion,enthusiasmmember of the armyrandom ticket drawdo again , say againslightly wet and dampriches,plenty of moneycomputer typing devicephotocopy of a documentsearch for something,huntperson suffering or harmedsoap bubbles while washingsewing or stitching materialplate placed under a tea cupshort coat worn over clothes...

Persuasive Vocab 2025-01-29

12 Items: The reason behind the argumentA rhetorical appeal to logic and reasonThe choice of words used in an argumentAcknowledging a point made by the opposing sideA rhetorical appeal to the emotions of the audienceInformation, facts, examples, or data that support a claimThe logical explanation that connects the evidence to the claim...

Metamorphicrocks Word Search 2024-04-09

11 Items: lack plates or stripesbands, sheets or platesform by the precipitation of mineralsform by the compaction of rock fragmentsform by accumulation of animal or plant debrishave large grains and cools for millions of yearshave small to medium grains and cools for thousands of yearshave invisible or microscopic grains and cools for seconds to months...

Community Word Search 2026-02-13

11 Items: Face-to-face contact with the family in their residence.The specific setting of our 3rd-day community immersion.The ongoing evaluation of nursing care and interventions.The method by which the nurse provides care using the PHN bag.The process of imparting knowledge to improve health literacy....

Meteorology 2023-03-08

27 Items: when liquid becomes a gaswhen gas turns into a liquidused to measure air pressurea tool to measure wind speedprotects earth from UV radiationa tool to measure wind directionmost common gas in our atmosphereozone at earth's surface is calledclouds that are flat and sheet likeof atmosphere where meteors burn uplayer which contains the ozone layer...

On Every Street - May 24th to July 27th, 2024 2025-06-30

29 Items: BellDunnGranLakeLundVimyBeachLucasMapleTaklaBegbieBegleyJaysonBedfordDicksonDolphinShaunnaClarissaMathisonMcTavishBenvoulinKirschnerMcDougallRiversideTwinRidgeBeaverLakeBeetlestoneHiddenRidgeBlackMountain

Golden Words 2014-03-19

12 Items: Iainisitoftobetheandwasthat

U.S. Constitution Vocabulary Word Search  2015-01-10

12 Items: ofbillrightspreamblerepublicpetitionarticlesamendmentbicameraldemocracyfederalismconstititution

Word Search 2023-02-15

12 Items: atoftoinisithetheandcancatsit

Gold Words 2023-06-23

12 Items: iabeinisitoftoandthewasthat

October 8, 2023 2023-09-17

13 Items: ofatthethecostdeliwellcrossnightsundayprayerworshipdiscipleship

Sight Word Word Search 2024-04-24

12 Items: doofmeheseeareyouforthatlooktheywith

Article of Faith #8 2025-01-18

13 Items: WetobeofthetheGodwordalsoBookBibleMormonbelieve

m100 search 2025-05-22

13 Items: ofitisinwasandyouwhythatthatwhatwhenwhere

Wk. 2 2025-09-10

12 Items: ofherseeyouthechatwhattheyshopswhipstheirsunset

List 8 2025-09-29

12 Items: ofdoshyshethisthatthenwithshadesheepbrushfresh

Word Search - Week of Oct. 20 2025-10-18

12 Items: ofwenogetputeatseewhyhelpworkdoeslive

Cuff Word Search 2025-10-21

12 Items: ofyoucuffpuffwillwellbelldollstuffsniffcrossbless

Heart Word Hunt 2025-12-04

12 Items: todoofmebeheasistheseeandsaid

breaking bad episode 4 2022-10-06

17 Items: -absorb or clear-slang for a hand job-slang for crystal meth-a dark granular mineral-cause (someone) to feel exhausted-the study and treatment of tumours-Cancer that forms in the glandular tissue-a main or large bolt in a central position-feeling or expressing overwhelming happiness-corresponding in size or degree; in proportion...

Gulf Amitriptyline 2023-08-23

13 Items: managed in divided ?is the tablet film coated ?Gulf Amitryptiline is used for?what is the colur of the label?hundred - what is the pack size?what is the strength of the tablet?true or false , has sedative effectscolour of the Gulf Amitriptyline tabletwe are on formulary with what med aid ?what type of antidepressant is Gulf Amitryptiline...

Spanish 2024-04-23

24 Items: inOfmyonTheTheHereyourSomeFlagdoorTherea fewmousechairTableclockItś aPosterNext toThere isKeyboardThere areOn top of

SCIENCE WORD SEARCH 2025-09-24

38 Items: pHatomacidloopcoreLipidcrustplatecyclemattermantleelementnucleusproteinerosionaquifermoleculecompoundinteractsolutionlandformnutrientfixationbiosphereatmospheredepositionhydrocarbonhydrosphereevaporationgroundwaterrespirationcarbohydratecondensationmacromolecule(lithosphere)transpirationprecipitationof conservation of matter

Care Management Spookys 2025-10-09

35 Items: fmstwotpnbertobrapetsaetnaadultcountyletterhumanaincomesitterappealsdeclineof stayratingscapacityconfuseddialysisdynamicstransferunhousedalgorithmbariatricinsuranceuninsuredof networkrestraintshealthcaresupervisionguardianshipauthorizationadministrationconservatorship

I Corinthians 14 2026-03-22

43 Items: PipeHarpTuneSignBareHymnUtterNotesGraspQuietWeighSoundsPlayedBattleAdultsSilentGiftedForbidSecretsWorshipAllowedReachedOrderlyPraisingPositionInquirersConvictedOriginateInterpretsUnfruitfulExclaimingInstructedSubmissionUnderstandsEncouragingDistinctionUndoubtedlyProphesyingDisgracefulAcknowledgeof languagesof ForeignersCongregations

Weather Vocabulary 2023-05-16

15 Items: measures the air pressuremeasures the speed of the windmove slowly and bring warm air upthe weight of air pushing down on Earthmeasures the direction of the blowing windmeasures the amount of heat in the atmospherecold air moves under warm air forcing warm air upmeasures the amount of precipitation that has fallen...

ch 4 vocab 2025-02-26

15 Items: Rate at which energy is converted.Energy that is due to chemical bonds.Machine that does work with only one movement.The ability to cause change, measured in joules.Energy a moving object has because of its motion.States that energy cannot be created or destroyed.Transfer of energy when a force is applied over a distance....

Elements of Art and Principles of Design 2026-05-11

14 Items: the lightness or darkness of a surfacehow the eye travels through an artworkthe path of a point moving through spacea flat enclosed area of space that is 2Dall elements within an artwork are in harmonythe difference between elements in a compositionregularly repeated elements such as shapes or color...