4th of july Word Searches

Safety Word Search 2024-10-17

18 Items: MILLMILLSHOPBALLWORKFIRSTREBARSTEELSTEELSCRAPOFFICEOFFICEBILLETFURNACEOUR FUTUREINNOVATIONPROCESSINGOF CHALLENGE

Magnolias on Monday, Tulips on Tuesday 2024-04-24

11 Items: full of bumpsnot normal, unusualto let something falla person who steals somethingWhat flower was missing on Tuesday?In the middle of Travnik was a _____ shop.Milan didn't stop because he was too _____.Milan's ears hurt because the _____ were very loud.Everyday this week, Milan has _____ a box of flowers....

Circulatorysystem Word Search 2024-10-18

24 Items: The male reproductive cell.The female reproductive cell.A substance that transfers heat effectively.The opening in the body through which air enters.The passage that connects the throat to the lungs.A substance that allows electricity to flow through it.The process of changing a liquid into a gas by heating....

MYSTERY MONTH: SHERLOCK HOLMES EDITION 2023-05-20

10 Items: their landladySherlock's citySherlock's addressnarrator and friendSherlock's arch-enemySherlock's older brotherauthor of Sherlock Holmestype of hat Sherlock wearsactor who played Sherlock on the BBChow many Sherlock short stories are there?

The Armor of GOD Words of Light and Life 2024-10-14

26 Items: GODfeetshodElahSaulrockwordswordpeacetruthdartsslinghelmetgirdlequenchwickedvalleygospelspiritGoliathwarriorsalvationTerebinthsbreastplatepreparationrighteousness

Languages of the World 2015-05-22

20 Items: UrduThaiZuluTamilMalayHindiArabicKoreanKoreanPunjabiRussianBengaliBurmeseSwahiliPersianMandarinJapaneseGujaratiCantoneseVietnamese

Words Of The Day 2016-02-03

19 Items: kindeptgritspoofadeptvitalfarceembarktussleadroitmettlelegacyrespectventureemulatescufflesalientaffinityintegrity

Changes of State Wordsearch 2016-05-22

19 Items: GasIceHeatSolidWaterLiquidMatterVapourEnergyMeltingKineticFreezingDepositionEvaporationSublimationTemperatureCondensationBoilingpointFreezingpoint

Monsters of the Deep 2019-04-26

19 Items: poddeepkindherosquidoceangiantnervessinewymermaidempathytentaclemonsterscaptivityrespectfulyouaresmartoceanographerhallucinationsmarinebiologist

Books of the Bible 2020-08-07

19 Items: JoelAmosHoseaJonahMicahNahumIsaiahDanielHaggaiEzekielObadiahMalachiJeremiahHabakkukZephaniahZechariahEcclesiastesLamentationsSongofSolomon

Parts of the body 2020-11-16

19 Items: eyearmlegearheadnosefoothandkneefacehairneckmouthtoothbellycheekfingereyebrowshoulder

Exploring Diversity of Matter 2021-09-19

19 Items: woodsofthardpaperglassmetalfibreshinyopaquestrongplasticbrittleelasticceramicsflexiblealuminiumconductorwaterprooftransparent

Clone of Rutinas #3 2023-02-14

19 Items: jugarcomercocinariralbañoducharseacostarsedesayunarlevantarsemaquillarselavarlaropadespertarseirdecomprashacerlatareaescucharmusicausareltelefonohacerejercicioandarenbicicletausarlacomputadoracepillarselosdientes

Fruit of The Spirit 2023-04-08

19 Items: joylovepeacecaringrejoiceblessedkindnesspatiencethankfulgratefulobedientgoodnesstoleranceendurancegratitudegentlenessforgivenessfaithfulnesscompassionate

Book of Mormon People 2024-01-12

20 Items: almalehinephiammonetherjaredlamanmoronisariahamulekmosiahgideonhelamanabinadihelamanteancumcoriantonzarahemlacoriantumrcaptainmoroni

Words of the garden 2024-02-23

20 Items: canbedsoiltreelawnweedhoseplantgrassshrubhedgemulchgardenflowerprunerpergolafountainbirdhousebutterflyfertilizer

Day of the dead 2024-05-02

19 Items: deadliferootsaltermexicoskullsspiritaztecsmexicanchaptertoltecscookiesmilleniadeceasedskeletontraditionancestorscelebrationdayofthedead

Birth of Jesus Christ 2024-08-14

20 Items: InnStarMaryHopeBornKingsJesusAngelGiftsDreamMangerJosephSaviorGabrielSheperdMessiahBetlehemNazarethChristmasChristmas

SFF 2022 2022-12-28

5 Items: PigskinBattle of 1836Founded in 1883Home of the SpursI prefer this with my soup

Baptism 2023-11-13

8 Items: a new convertimpossible to eraseWashing away all the dirty stuff - sins.getting dunked under water to remove original sinrite has to take place in order for the sacrament to counta consecrated ointment consisting of a mixture of oil and balsam....

The Rubicon's Word Puzzle 2024-01-23

6 Items: the builderTroy's mascotcolor of the skythe Hispanic builderTroy's literary journalLast name of civil rights activist & revered

Spanish 1 Vocab 2 2024-02-22

31 Items: pendaybookyearweekmonthtodaymarchfolderpencilmondayfridaysundaytuesdayjanuaryfebuarynotebooktomorrowthursdaysaturdayclassroomwednesdaystudent deskstudent(male)Teacher(male)sheet of paperstudent(female)Teacher(female)what is the date?what day is today?it´s the first of...

People and Places of Creatures of Light and Darkness 2013-06-02

28 Items: SETISISBLISLIFEWANDWAKIMMEGRAHORUSTHOTHDEATHNORNSSHOESGLOVEANUBISOSIRISVRAMINMADRAKDILWITKALGANTYPHONSEXCOMPDDONORIMARACHEKNAMELESSCERBERUSMIDWORLDSLIGLAMENTIINTERLUDICI

Science Vocabulary 2023-03-28

20 Items: DNA has a double _______ shape.A cell without a nucleus. _____________________The powerhouse of the cell. _____________________The control center of the cell. _____________________Charles __________ is known as the Father of Evolution.In _____________________, DNA is converted to an RNA code....

Business Studies 1.5.3 & 1.5.4 2024-05-12

10 Items: a good whose demand drops when people's incomes risea good whose demand rises when people's incomes riseThe number of people willing to work but out of work and seeking workFit for ________ The goods and services should be fit for the reason they are supplied for,...

Business Studies 1.5.3 & 1.5.4 2024-05-12

10 Items: a good whose demand drops when people's incomes risea good whose demand rises when people's incomes riseThe number of people willing to work but out of work and seeking workFit for ________ The goods and services should be fit for the reason they are supplied for,...

Dantealighieri Word Search 2022-08-28

15 Items: Belief in no god.Belief in one god.Milton's epic poem.The Devil's primary job.Another name for Satan, starts with a "B".The Devil's feet are often drawn this way.Writer of "Inferno" and "The Divine Comedy".The Devil is also referred to as the Prince of ________.Location where Eve tempted Adam with the forbidden fruit....

Unit 5 - G&L Roots 2024-09-24

11 Items: To widenTo divide upDependent uponDesire to avoidPlace of actionTo scatter aboutAbove all the othersDemanding perfectionTo cause to move forwardBody of ideas, achievements, and moralsSeeking to find a problem before it occurs

Tale Word Search 2023-10-20

10 Items: A group of animalsTo move like a waveAnother word for storyTo push something forwardPast tense of the verb "to hear"To discuss and exchange opinionsA picture made from a group of starsThe time and place where a story happensDone exactly the same way, all the time, ever time.What dogs and cats have (attached to their back or behind)

ww5 u7 2024-04-16

14 Items: very coldto lay downstrong or solidto crowd togetherto be like or similar tofar away in time or spacehaving little strength, weakto make up for; be equivalent torough or unpleasant to the sensesto attract or firmly hold the attention ofbeing alone or lacking the company of othersto walk with short steps, swaying from side to side...

Energy Transformations & Transfers 2024-10-16

14 Items: Energy in atomsEnergy of motionEnergy stored in breadEnergy at the top of a hillA middle point on a pendulumKinetic plus potential energyA form of electromagnetic radiationEnergy changing from one type to anotherEnergy moving from one object to anotherEnergy that an object gives off as it movesWe cannot make more energy or _________ any...

2024 Spring Into Security Word Search 2024-03-13

15 Items: Study of secure communication techniques.Unauthorized access to sensitive information.Software update to fix security vulnerabilities.Simulating cyberattacks to evaluate security defenses.Weakness in a system that can be exploited by attackers.Manipulating people into divulging confidential information....

Ride of Your Life 2018-04-15

19 Items: barcargatelineseatbeltboothlockerticketteacupscarousellogflumebumpercarspirateshipferriswheelriverrapidsflyingswingshauntedhouserollercoaster

Ends of the Earth 2022-10-24

19 Items: skyactsbackcomesamecloudcomesearthjesusjudeapowerheavenreceivesamariatakenupholyghostjerusalemwitnessesholyspirit

rooms of the house 2023-11-06

20 Items: roomyes/i/am.no,/i'm/not.where/are/you?mom/and/dad/arein/the/kitchen.it's/the/bedroomwhere/is/sister?where/is/brother?where/is/grandpa?grandpa/is/in/theit/has/bed/pillow/and/blanket/insidei'm/in/the/classroomi'm/in/the/classroomit's/the/room/we/sleepwhere/are/mom/and/dad?sister/is/in/thebedroomare/you/in/the/bathroom?brother/is/in/the/bathroom.

Employment Strategies 2014-11-08

35 Items: ofJobSTARWorkCodeSelfTalkCoverVerbsPhoneSMARTGoalsletterActionResumeSearchCareerActiveEthicsNetworkProfileLinkedInPositiveInterviewPortfolioInterviewListeningObjectiveEducationReferencesExperienceApplicationIntervieweeInterviewerChronological

Homework Jesse Tree Symbols 2014-12-09

36 Items: oframthelawmaletreetentcoatbushpalmtreelampharpbookdovecamelcrookmusicnotesstrawjesseriverangelfigurefemalefigureladderbranchthronemangerrainbowburningcolumnstabletscolourfulshepherd’s

unit 9 2019-01-23

34 Items: ofeatratgetridlipjoyleadcomedealdeadtunemainpiperscaremayorflutepounduntildrownspokenfulloffollowsilvermissinghappilybelieveagreeonproblemterriblysurprisedcharacterstorytelleronceuponatime

Math Vocab Part 1 2024-05-08

35 Items: isoftaxtipratepartwholemixedratiowholemarkupintegernaturalpercentoppositezeropairrationalimproperunitratediscountgratuityinterestmarkdownascendingnumeratorprincipaldescendingcommissiondenominatorconstantrateproportionalabsolutevalueconstantofpropadditiveinversenonproportional

Sources of finance. 2023-09-02

10 Items: repossesstradepayablesretainedprofitexternalfinanceresources used or owned by a business.Long-term finance secured with propertyfinance provided by the owner of a business.generated by the business from its own means.one or a series of regular payments made until all the money owed has been paid off....

BAHASA INGGRIS LANJUTAN ( ARGUMENTATIVE TEXT) 2023-08-29

10 Items: a condition giving benefits.component or elements of something.a text that used to promote the productlaunch to release a product in the market.piece of text that presents one side of an issue.it is more personal, emotional, biased, and informal.the reason why a writer writes about the topic he/she is talking about....

HOW A POTENTIOMETER WORKS 2024-05-01

10 Items: What component can vary current in a circuit?How many terminals does a potentiometer have?What is the third color band on a 100 Ohm resistor?What is the color of the negative lead on the battery snap?A potentiometer is a variable ___________________________ .The word LED stands for Light-Emitting ________________________ ....

Chapter 6 2024-10-19

10 Items: concept maptext variationLooking up dataTesting someonechoose any stylesave as a range of filestells a device what to dospelling or grammar checkbuilding an image with layersElements or structure of something

CRACK THE CODE 2024-10-08

18 Items: – Too Long– Hit Me Up– Oh, I See– Got To Go– By The Way– Never Mind– Any Day Now– Bye For Now– Where You At– See You Soon– At The Moment– Out Of Office– Ta Ta For Now– Do It Yourself– Not A Good Idea– Behind The Scenes– Fear Of Missing Out– Same Stuff, Different Day

9327 Rich Man and Lazarus 2024-03-06

10 Items: Animals that are often kept as pets.The name of the poor man in the story.Having a lot of money or valuable things.A door in a fence that you can go through.A big meal for celebrating, with lots of food.Small pieces of food that fall off when you eat.Painful spots on the skin that can be sick or hurt....

dessert 2024-07-19

15 Items: A French pastry made from choux dough filled with cream and topped with chocolate icing.A rich, chocolatey square or rectangular baked dessert, often dense and fudgy in texture.A small cake baked in a cup-shaped container and typically decorated with frosting or other toppings....

dessert 2024-07-19

15 Items: A French pastry made from choux dough filled with cream and topped with chocolate icing.A rich, chocolatey square or rectangular baked dessert, often dense and fudgy in texture.A small cake baked in a cup-shaped container and typically decorated with frosting or other toppings....

dessert 2024-07-19

15 Items: A French pastry made from choux dough filled with cream and topped with chocolate icing.A rich, chocolatey square or rectangular baked dessert, often dense and fudgy in texture.A small cake baked in a cup-shaped container and typically decorated with frosting or other toppings....

CH4 - Plate Tectonics 2022-12-19

14 Items: Stress that squeezes rock until it folds or breaks.________________________A force that acts on rock to change its shape or volume.________________________A plate boundary where two plates move toward each other.________________________A plate boundary where two plates move away from each other.________________________...

unit 10 what is your job ? 2023-03-13

14 Items: legal agreementmake a formal requestemergency room in a hospitalsomething which causes worrythe work of building somethingthe ability to do something welllearning skills you need for a jobperiod of time working to learn skillsskills that make you eligible for a jobqualification when you finish universitydoing something that makes you feel good...

Medieval Times 2014-05-10

35 Items: ofleoIIIthelordkingguidpagenunspopepopegaulmailguildmanormonkssignsnoblemagnacartachainvassalknightempiresquirechurchpeasantrichardeleanorjoustingaquitinebyzantineonheartedcharlemangemissionaries

Cycle 1 Vocabulary Week 1 2024-08-27

5 Items: consists of variables, numbers and operationsmaking a statement or situation less confusedthe number of protons in the nucleus of an atoma person not in the armed services or the police forcethe refusal to comply with certain laws as a peaceful form of political protest

Personal Relationships (Lessons 3 & 4) 2024-10-17

30 Items: To shameA teacherLike an uncle.Childish; immatureAbout to die or endA rebirth; a renewalA family inheritance.Support; encouragementMarriage to two mates.Dominated by one's wife.Marriage to a single matePossessed at birth; inbornChildlike; unsophisticatedHaving to do with the family.Emerging; coming into existencePertaining to brothers; brotherly...

Theories of Career Development 2014-10-09

19 Items: workstylevalueparsontheoriescognitivevocationalpsychologymesosystemadjustmentindividualdevelopmentpersonalitymaintenanceoccupationalactualizationsociallearningconstructivistscrystallization

The lesson of countries 2015-02-13

19 Items: romeberneuroalpsitalyparisfrancelondonfrenchgermanenglishitalianrepublicromanschswitzerlandswiss-francconfederationunited-kingdompound-sterling

The lesson of countries 2015-02-13

19 Items: romeberneuroalpsitalyparisfrancelondonfrenchgermanenglishitalianrepublicromanschswitzerlandswiss-francconfederationunited-kingdompound-sterling

Wild Animals of Florida 2017-02-14

19 Items: GarBearDeerBoarBassHawkGatorBobcatMulletCoyoteGopherPantherKeyDeerManateeMallardPeacockMoccasinFlamingoMockingbird

Week of 10/15 2018-10-19

19 Items: BatRunVastVoteBallHomeSternWearyLoyalWorldGloveNimbleSeriesLeagueElectionBaseballPlayoffsStadiumsCandidate

Week of 2/4 2019-02-08

19 Items: BBKingthinkmonthbrushflossLouissafetybeforedentalhealthfamousArethapostinginternetFranklinmouthwashmusiciansArmstrong

3 Branches of Government 2019-10-15

20 Items: lawslawsbilljudgesvetoesnationSenatorfederalcabinetCapitoljudicialcongressbranchesjusticesexecutivePresidentWashingtongovernmentlegislativeconstitutional

The art of memory 2022-02-05

20 Items: locitextsmemorygeniuscrutchvirtuemethodcertaincomplexmemorizeexternalexternalmedievaltechniquevisualizeknowledgegraduallycollectivemillenniumachievement

The Tree of Life 2024-04-14

19 Items: godjoycomefeellehilovefruitpeacewhiteworldbrightfamilyvisionshiningbeckonedgladnessgreatestsweetestbeautiful

Women of the Bible 2024-08-14

20 Items: EveLeahRuthMaryAnnaSarahRahabTamarRachelMiriamHannahEstherMarthaRebekahDeborahAbigailDelilahBathshebaElizabethMagdalene

The Odyssey Book 21 Word Search 2023-03-16

8 Items: The CowmanThe BeggarThe SwineherdOdysseus' kingdomThe Amount of AxesMain Leader of the SuitorsPlace From Which the Bow was ShotPerson who Makes a fire in the Hall

unit 13 2024-03-07

12 Items: enemyfightto keep safeto get ones ownto show clearlydull as a resultcloser to the enda discussion of reasonshaving to do with healthsomething done successfullyhappening in many places at oncethe cruel killing of many people

Chapter 14 Terminology 2023-05-22

39 Items: This is the percent of time the network or service is up and accessible.Tools that can look up information such as an IP address from a domain server.This refers to redundancy to provide access in the event of component failure.A command that displays network connections for Transmission Control Protocol (TCP)....

CRACK THE CODE 2024-10-08

18 Items: – Too Long– Hit Me Up– Oh, I See– Got To Go– By The Way– Never Mind– Any Day Now– Bye For Now– Where You At– See You Soon– At The Moment– Out Of Office– Ta Ta For Now– Do It Yourself– Not A Good Idea– Behind The Scenes– Fear Of Missing Out– Same Stuff, Different Day

Proportional Word Search 2022-12-06

7 Items: ratepairratioequationrelationshipproportionalof proportionality

vocabulary menu 2022-12-01

7 Items: ratepairratioequationrelationshipproportionalof proportionality

Civil War 2023-02-22

12 Items: Union PresidentPolitical cartoonMost capable generalConfederacy PresidentWhere Civil War endedWant to preserve UnionFirst shots in Civil WarLed army of Northern VirginiaWant to preserve States Rights"Total War,"caused destructionNicknamed for bravery, Battle of ManassasSpeech by Abraham Lincoln. Preserve Democracy

The count Dracula 2023-03-26

7 Items: Good houseThe opposite of HappyConstrucción materialBody parte top of spinePeople working on a shipSomething or someone you likeWhen something excites or scares

Unit 7 2022-10-24

12 Items: found ofgood naturedcalm and wisewarlike in natureone who is hostileone who loves booksoccurring before warnot bitter or hostileto act hostile towardswarlike mood or attitudecharitable donation to public casesthe central character in a work of literature

T Words 2023-04-11

10 Items: a turning or twisting forceto occur; happen; take placean area, region, or piece of landexperimental in nature; uncertain, hesitanttoo long, slow, or dull: tiresome or monotonous.(v.) to oppose successfully; to prevent, frustratethe path followed by an object moving through spacethe special words or phrases that are used in a particular field...

Software Testing Final Extra Credit Spring 2024 2024-04-21

10 Items: one loop after anotherone loop inside anotherbasic measure of software sizeloops where one branches into the middle of anotherwraps the source-code with AST information in the form of XML tagscharacterized by shared ownership, workflow automation, and rapid feedbackcontinuous _____ - automatically deploys code changes to customers directly...

Classroom scavenger hunt 2024-09-04

10 Items: One of the community agreements.The ________ supports your claim.The color of the hallway pass for this class.Find your _______ number hanging above your head.Mr. G's favorite hockey team is the Boston _______.If I need to blow my nose, where would I find the _______?Absent? Find your daily _____ in the crate at the front of class....

Industrial Revolution 2024-02-27

17 Items: ginmuleloomWattjennyframepartsenginesystemshuttletextilesof laborindustrysocialismproductionrevolutionurbanization

Proportional Word Search 2022-12-06

7 Items: ratepairratioequationrelationshipproportionalof proportionality

The lesson of countries 2015-02-13

19 Items: romeberneuroalpsitalyparisfrancelondonfrenchgermanenglishitalianrepublicromanschswitzerlandswiss-francconfederationunited-kingdompound-sterling

The language of Insights 2017-05-10

19 Items: goalfocustrendscreatedrelatedresultedsuggestsindustryapproachmomentumconsiderstrategyindicatessignifiesrecommendtrajectorycontributedrelationshipcomplimenting

Patriots Hall of Fame 2020-05-08

19 Items: LawLightFaulkBrownNanceCoatesGroganNelsonHannahBledsoeTippettBruschiHarrisonClaybornMcGinestArmstrongCunninghamBuonicontiCappelletti

The Elements of Music 2020-10-07

19 Items: lowloudsofthighfastslowthinlongTempoPitchthicksoundshortTimbreRhythmTexturequalityDynamicssilence.

Books of the Bible 2022-10-25

20 Items: marklukejohnactsjohnpeterexodusjoshuaestherpsalmsgenesisnumbersmatthewhebrewsproverbsjeremiahzechariahrevelationdeuteronomyphilippians

Care of Magical Creatures 2023-10-31

19 Items: dragoncentaurmermaidnifflerphoenixbasiliskbillywigdiricawlgraphornthestralwerewolflethifoldravenclawslytherinbowtrucklegryffindorhippogriffhufflepuffacromantula

Acronyms 2023-11-16

20 Items: benefit Groupchild supportearned incomelong term carebehavior healthdate of serviceAccess to Recoveryfederal match codeAffordable Care ACTfair hearing BureauBureau Indian affairsdepartment of justiceBlue cross blur shieldAutomated teller machineindividual education planProtected health informationmedical assistance department...

Asked & Answered 2023-12-31

10 Items: What kind of spirits are banshees?A type of divination that involves eggs.Provide the incantation for the Gouging Spell.What colour is the Potion for Dreamless Sleep?The flutterby bush produces flowers once a _____.What is the incantation for the Gouging Spell again?What is the process of turning base metals into gold called?...

Unit 18 2024-03-05

12 Items: causing damage, harmfulcheerful and full of lifein a dying or death like stateable to be broken down naturallyto preserve in the memory foreverharmful to physical or moral healthto cause the extreme embarrassment tothe act or process of bring back to lifetaking an unhealthy interest in unpleasant things...

great depression 2024-10-08

8 Items: biggest economic disasterpeople went without homesperson who runs the united stateswent without food for a period of time \a series of programs that FDR came up withman who got us out of the great depressionman who every one blamed the great depression onchat a thing FDR came up with to communicate things

Unit 17 2023-02-23

12 Items: Causing damage, harmfulCheerful and full of lifeIn a dying or death like stateTo cause extreme embarresment toAble to be broken down naturallyTo preserve in the memory foreverHarmful to physical or moral healthTaking an unhealthy intrest in unpleasent thingsMutualy beneficial, supporting one anothers life...

PE 2 2023-09-26

31 Items: enHoymayolunesjueveeneromarzoabriljuniojulioNievaMananamartessabadoagostoLlueveviernesdomingofebrerooctubreHace solmiercolesnoviembrediciembrepor favorHace frioseptiembreHace calorHace vientoEl InviernoLa Primavera

Bolígrafo Word Search 2024-10-03

35 Items: pendayMaybookyearweekJuneJulymonthtodayMarchAprilfolderpencilMondayFridaySundayaugustseasonstudentstudentteacherteacherTuesdayJanuarynotebooktomorrowThursdaySaturdayFebruaryclassroomWednesdaystudentdeskIt's rainingIt's snowing

Bolígrafo Word Search 2024-10-03

35 Items: pendayMaybookyearweekJuneJulymonthtodayMarchAprilfolderpencilMondayFridaySundayaugustseasonstudentstudentteacherteacherTuesdayJanuarynotebooktomorrowThursdaySaturdayFebruaryclassroomWednesdaystudentdeskIt's rainingIt's snowing

Fahrenheit 451 Word Search 2024-01-16

10 Items: Montag's selfish wifeThe girl who was killedA device used to shoot fireA retired English professorA chemical used to burn thingsThe captain of all the firemenThe main character of the storyA group of people who burned the booksA fireman who is responsible for burning other people's houses...

Vocabulary - 8A 2024-02-13

10 Items: All parts as a whole.A thing that may be chosen.A way of exchanging information.Easily understood or clear to tell.A limitation or restriction to something.A person engaged in a specified activity.A state of being different from something else.A discussion on a particular topic with others.A way of feeling shown through someone’s behavior....

United States History Chapter 2 2013-10-03

36 Items: ofandrulefreecostruralurbansuburbbranchbranchbranchchecksmarketprofitsupplydemandcultureeconomyfactorsservicerepublicjudicialbalancesmajorityindustryimmigratedemocracyexecutivetrade-offpatriotismpopulationgovernmentproductionlegislativeconstitutionmanufacturing

After testing 2022-05-16

36 Items: xyofGCFaxisaxiszerovalueplaneorderoriginnumberreviewalgebranumberstestingproductdegreesabsolutepositivenegativeadditiondivisionrationaldistanceintegersquotientimpropercomparingfractionscoordinateoperationssubtractionreflectionssupplementarycomplementary

Atomic models 2024-05-19

33 Items: atombondbohrmodelionicdaltonmetalslusterelementthomsonductilequantammoleculecompounddiatomiccovalentmetallicmixturesisotopestriatomicnonmetalsruthefordmalleablepostulatesmetalloidsfiltrationpolyatomiccompositionelectroysishomogeneousdistillationheterogeneoussea-of-electrons

Bonus 2023-01-07

9 Items: latetimeprebussittingrunningrunningcellphoneof servicecall no show

Overcome 2024-01-15

32 Items: notmindloveevilgoodmindwiseweepjesusbloodpeacewrathprayerlivingsaintsforgiveconformof lifeblessedconceitrejoicerenewingentangledsacrificepeaceablyvengeancecondensedpersecutenecessityrecompensetransformedhospitality

Socioeconomic disparities 2023-11-30

8 Items: Nurses primary commitment is to the.What are nurses obligated to do for their patients?One way to bridge the gap associated with socioeconmic disparitiesType of technology that helps lessen the challenges of a language barrierThis helps improve patient outcomes and identify social determinants of health....

Official Mainah Slang 2022-06-06

12 Items: wi-fithis is a carcute or adorablegoing snowmobiling upta campa four legged animal with antlersvisitors from away, usually Massachusettsmeans yes, or at least acknowledgement form a Mainaha cove off the ocean, like Bah Hahbah, or Cape Porpoise Harbora Fair or festival of farm animals, rides, craft and fried dough...