4th of july Word Searches

Birthday party mother 2023-03-21

37 Items: boywkdbeercakecokegirljunejulylovewinemarscomefantapepsimusicchrissweetmarchaprilwarpsfantapeopledrinksfamilysisterauntiesummerballoonbrothersausagechickenjanuarybirthdayinvolvedsandwichfavouriteenjoyning

SUMMER VACATION 2023-05-16

36 Items: junejulypoolbeachrelaxaugustbikingfamilyhikingsportssummerlotioncampingfishinghammockpicnicsreadinghotdogssandalsboatingbarbecueicecreamlemonadememoriesswimmingvacationsunshinegardeningpopsiclestravelingsunscreenflipflopswatermelonhamburgerssunglassesstrawberries

Wedding Word Search 2024-06-23

36 Items: cakejulyloverenovowsalterbrideducksgroommilespartyringstoasttrustwhitechristchurchdinnerfamilygospelbouquetdancingflowersforeverpromisevanillaweddingceremonyfebruarygonzalespicturesfirstkisshoneymooninstagramofficiantcommitment

Sleep 2023-06-10

14 Items: moodmemoryanxietylearningsnackingcaffeineconsistentrelationshipsEmit blue light that affect sleepLack of sleep can lead to ___ gainDaytime rest that can affect nighttime sleepTeens should get ___ to ten hours of sleep a nightIncreased risk of ___ and injuries (drowsy driving)Weakened ___ system increases chance of getting sick

Spelling Test 3 2022-09-23

28 Items: against slaveryhostile; unkindunfit to be eatenthe act of going awayto repeat or say againone who is not a memberbefore recorded historythat which is not nuclearoccurring twice in a yearto stop or prevent an actionapart from one's choice or willto go do, come down, fall, or sinkof the highest degree or importanceextending across the Atlantic Ocean...

Centenary Word search Complete the Title 2024-04-03

23 Items: _____-22Open _____I Am ______White _____Cloud ___________ ZhivagoEye of the ______Things Fall _____The ________ BrideThe Story of _____A Passage to _____Midnight's ________The _________ StormA ____ of One's OwnLessons in _________Long Walk To ______________ Jones's DiaryWhere The Crawdads ____A Brief _______ of TimeFive Go Adventuring _____...

Key Terms chapter 18 2023-04-14

27 Items: walkinglying face downstyle of walkingfluid-filled sacsside-lying positionlocal death of tissueresting on their backHOB is at 60-90 degreesHOB elevated 30-45 degreesDense, hard connective issuepatient resting on their sideis Also known as body mechanicsoccur from pressure on the skinfibrous connective tissue-cushion...

Pinchas 2024-07-20

18 Items: Moses successorThe seventh day.Phinehas’ father.Daughter of Asher.Jeremiah’s hometown.Zimri was from this tribeSimon was know as a _______.Phinehas’ reward for his zeal.The 14th day of the first month.his Hebrew name means “3 Israelites”The new moon or the first of the month.Cozbi was the daughter of this Midianite prince....

☆Echo Word Search!☆ 2024-04-22

30 Items: The scientific study of insects.The scientific study of language.The art of thinking. Translated from Greek into "the love for wisdom".French composer and pianist, known for his Gymnopédies and Gnossiennes.Fictional band, created by Blur frontman Damon Albarn and artist Jamie Hewlett....

Topic 6 DEVELOPMENT OF HARDWARE, SOFTWARE & TELECOMMUNICATIONS SYSTEMS 2024-05-02

21 Items: The brain of a computerSemiconductor materialsThe delivery of computing servicesMaterials that have a conductivityA set of recognizable and verifiable dataThe capacity of a device to hold and retain dataPhysical components of a computer that you can touch and see.Set of instructions and programs that tell a computer what to do...

Evolution Word Search 2022-08-24

15 Items: A segment of DNA that codes for one specific protein.Changes within a population over long periods of time.A visible characteristic due to an individual's genotype.The passing down of genes from one generation to the next.An evolutionary force due to mate selection and preference.A genotype where both alleles of a given gene are the same....

Voters and Voter Behavior 2022-10-04

25 Items: having an influence on politicsa person with no party affiliationillegal voting or tampering in an electiona person who has been convicted of a serious crimethe practice of voting for candidates from only one partythe practice of voting for candidates of more than one partya set of basic beliefs about life, culture, government, and society....

: The Consequences of the Industrialization 2022-12-01

26 Items: The action or process of appeasing.Centralized control by an autocratic authorityTreaty that ended the first Opium War in China.A law that restricting Chinese immigration in the U.S.A law that restricted non-European immigration in Australia.A German philosopher that came up with the theory of Communism....

4th Grade Vocabulary Words 2022-02-10

14 Items: defyvasteagertauntbrutalcomplexdeclineparchedrivalrycollapseshortagebountifulnegotiateboisterous

Christmas and more 2022-12-16

27 Items: elfpolestarjudekerrcarolgravysantaangeljesuscaroljamieturkeypotatocarrotsleighjumperskiingchickenpuddinglaplandsproutsscroogereindeerchristmasof new Yorkghosts of Christmas past

Nutrition 2022-12-13

35 Items: Blood sugarFruit sugarStart of digestionIndigestible starchComplex carbohydratesVitamins and MineralsGetting enough to eatPre-cursor to Vitamin ACarbs, fat, and proteinOne of the macronutrientsNeeded for blood clottingBuilding blocks of proteinIron found in animal foodsVitamin B12 is stored hereNatural source of Vitamin D...

Elizabeth Word Search 2024-07-11

35 Items: Tom’s middle nameTom’s zodiac signKelly’s middle nameKelly’s zodiac signState they eloped inCity Tom was born inThe clear favorite catCity Kelly was born inKelly’s Hogwarts houseSeason they got engagedWebsite the couple met onFavorite video game systemCity of their first apartmentName of Kelly’s oldest siblingName of Tom’s youngest sibling...

Atoms 2024-01-07

13 Items: The fundamental unit of a chemical element.High-energy photons generated by radioactive decay.A solid material made of atoms arranged in a geometric pattern.A chemical element with the same number of protons but different numbers of neutrons.An atom or molecule with a net electric charge due to the loss or gain of an electron....

Nervous System 2023-02-05

14 Items: action under our controlThe largest part of the brainregulates blood pressure and breathingconnects your brain to your spinal cordextends downward from the base of your brain.voluntary control of body movements via skeletal musclesbest known for its role in responding to dangerous or stressful situations...

science review wordsearch 2023-06-01

22 Items: Unit for workThe transfer of heat in the form of wavesHighly reactive nonmetal elements in group 17Solution that has more solute than the solventHow tightly packed the atoms are in a substanceDescribes both the speed and direction of an objectReactions that release thermal energy when they react...

Cat Word Search 2024-04-25

37 Items: catdogmanmaysadbigbestlionjunejulyfallmathopendeskzebrahippomarchaprilhappysmallchairfriendaugustwinterspringsummerclosedjanuaryoctoberreadingsciencehistoryelephantfebruarynovemberdecemberseptember

Garden Word Search 2024-02-22

20 Items: (Clue: The first man)(Clue: The first woman)(Clue: God's promise symbol)(Clue: Jacob's twin brother)(Clue: Father of many nations)(Clue: Where Adam and Eve lived)(Clue: Adam and Eve's first son)(Clue: Son of Abraham and Sarah)(Clue: Joseph's master in Egypt)(Clue: Tempted Eve in the Garden)(Clue: Built an ark to save animals)...

9306 Shoes of Peace 2023-12-25

10 Items: A follower of Jesus.Told off or scolded.Son of God, Savior, and Lord.Belief and complete trust in GodBeing in a state of rest, not awakeReally surprised, in awe of somethingReally bad weather with lots of wind and rain.A kind of vehicle that floats and moves on water.A big area of water that is smaller than an ocean...

Have fun 2024-04-26

12 Items: Egregioussweet or musical pleasant to hear.hazy, vague, indistinct, or confuseda group of people that make decisionspleasant odor that is associated with rainexisting or being everywhere at the same timefull of, marked by, or causing complete happinessgood luck in making unexpected and fortunate discoveries...

JULY 2024 EASC--GEARS CALENDAR NOTES 2024-06-18

40 Items: daybookbusyhandheatjessjulymattrosetownbiblebingochaircloselovednightwalesafricaaugustcraftsdanielhealthheavenpuertotraveltriviacookoutfinlandfridayspackingtrafficnoontimeolympicstabletopwhackershydrationsingaporediscussionvolleyballelizabethtown

animales-colores-trabajos 2023-03-02

20 Items: of bloodof grassbest friendof flamingosof the junglecolor of the oceanjob is to take picturesanimal with a long neckanimal that eats bananasanimal that likes cheeseanimal that produces milkthat you kill to make baconinsect that makes honeycombs- an animal that has 9 livesof cummings high school floorthe profession that flys planes...

Spanish Feelings 2023-03-01

20 Items: FelizWorse version of saduncertain and anxious.Unable to think clearlyextreme verison of HappyExtreme version of angryworse version of enviousA person who is shouting is....When you scrape your knee it...when you cant wait for anythingExpressing distress and annoyanceWishing for what other people haveWhen you have stuff to do you are......

Parshat Shemini 2024-04-05

15 Items: Hebrew for "Tabernacle"Moshe gets upset with himHebrew for "Divine presence"Another word for split hoovesKosher fish need _ and scalesHebrew for "impurity" (not found on Chabad)The Torah lists the kosher version of this insectAaron's sons died after bringing this type of offeringKohanim are told not to drink this before doing the avodah...

Prefix and Suffix Spelling Words 2023-04-28

15 Items: To fold againWith fear, scaredTo open or spread outWithout fear, not scaredCan be used for many purposesTo express a different opinionThe forming words from lettersExtend for a longer period of timeThe quality of being friendly or considerateA group of letters added at the end of a wordTaken after you study to show what you learned...

Birthday party July handsome and Roisin 2023-07-02

44 Items: hamginbbqbapscokecakesingbeerwinegoodnicefoodfantacripssweetpepsimusicdrinkpartyrollspizzachipssaladkaiteonionburgermccoyspotatofamilysisterunlessauntiecheesesausagechickenbrotherballoonscolaslowicecreambangeringchocolateporospccosausagerollscongratulations

Birthday party July handsome and Roisin 2023-07-02

44 Items: ginbbqMaryDaveLovesingbeerwinegoodnicefoodGlennNiamhcripssweetpepsimusicdrinkpartyrollspizzachipssaladkaiteonionRoisinSeamusmccoyspotatofamilysisterunlessauntiecheeseCaitrinbrotherAishlinnSandwichPeasantsicecreamchocolateporospccosausagerollscongratulations

Us 2024-04-05

26 Items: Our youngestOur firstbornOur middle childAge of the brideBest man at weddingMonth we got marriedType of party we met atMaid of honor at weddingSong Teresa sang at weddingWe both prefer these to dogsWe lived there for six monthsShampoo Byron used when we metWe've been married this many yearsBuffet in Eugene that we frequented...

Inherent Powers - Word Search Activity 2024-01-28

11 Items: The Supreme Law of the Landthe Contract that Ended World War OneMs. Mangum’s Favorite Color (x2 points)Purchase made by President Thomas JeffersonA Form of Government that the United States HasDocument Written by Abraham Lincoln to Free the SlavesConsists of the House of Representatives and the Senate...

Flowers 2024-03-25

30 Items: irisrosedaisypoppyglorypansytulippeonyvioletorchidjonquilfreesiadaylilydaffodilsweetpealarkspurgladiolamarigoldprimrosemagnoliahyacinthcarnationwaterlilysunflowerdandelionbluebonnethoneysuckleof paradiseof thevalleychrysanthemum

Spelling 4th Grade Unit 1 2013-08-26

25 Items: scrubthroatscreenscreamstreetstrikesquarethreatthrownthrillsquealsquirmsquirtthroughscratchstrangesqueezestrengtharthritisastronautskyscraperstrawberryinstrumentsqueezabledescription

Los nombres de 4th grade 2019-04-11

21 Items: MyaToniAmeerArianTymirKelliEliasMarionCarterVictorNicoleMinearBarleyBrandonMShyiahMikaylaGellmanEspanolLanyijahKrystaleMcKinley

Meet out 4th Grade Class 2020-08-27

22 Items: AvaLiamNoahKylieDanteAveryDavidDylanDilnazAlishaKeatonOliviaColtonHenrryCarterDBraedenCaitlinCarterMBrielleMrsMercerValentinaAlexandria

4th Grade Vocabulary Word Search  2021-03-04

35 Items: summaskzoomhalftradewholesixthrhymecohortLenapewampumwigwammutinyfourtheighthpoetrysimilejusticeprotestimagerysanitizeequalitywoodlandsettlersnavigateEuropeanfractionmetaphortemperateencounternumeratorindigenousequivalentchoiceboarddenominator

Mrs. Gallagher's 4th Grade Class 2021-08-26

25 Items: JaxLeahAdeaLukeNoahJackAnishAveryMargoGradyDylanQuinnArleeElvinJacobRileyAubreyGiorgiAlyssaSerenaHarperBellamyDominicSamanthaKonstantin

Miss McGinness's 4th Grade Class! 2022-08-15

23 Items: ivyzoebenkhoihopelevielinrowanclaragavinreesedavidbrycemaseegiannasydneybentleyjamesonbraydendominicgiovannicharlottemissmcginness

Mrs. Doody's 4th Grade Class 2022-08-29

23 Items: jaxianlilajunesaraevanjaynecolinloyalgracejacobdanielmaggielandontravisjudithhaelynraymondabigailcharliejillianbrooklynaubriana

Find Yourself in 4th Grade 2022-09-07

28 Items: evasageannatobymayaalexavivanitindavisaveryethantaiyosamsonemeliakullenjustinaudreygabrielkristinmichaelgabrielfrankiejeremiahannabellemshanshewmspatalanochristophereamessimone

Mr. Cruz 4th Grade Science 2023-05-19

70 Items: benokashaalenbonecruzevankwonneryvinhzachbicepcubbydaviselitaethanpaintprimesofiaalyssaameliaberthachapeldaltondamieneaglesenergyheavenjulianmorganmusclepencilretinaselinasophiastellasummertendonallyssaariannacharliedanielaerosioneyeballfossilsgabrielmachinemysteryrodrigosciencesheltonvolcanodingtingeruptionferralezjewelisaprizeboxskeletonsupplies...

MAPEH Word Search 4th Quarter 2023-05-20

20 Items: lisztsambasignschopincanovamedusachacharhumbasurveyballadegarnierbandagecarnavalschumanndressinggericaultrocknrolllocomotoremergencythorvaldsen

Ms. Reid's 4th Grade Class 2023-08-23

25 Items: eldajudeaydenethanayaanaaravpranavisaiahhannahjoshuaishanialishaeshaanmsreidbrendanpiersonashwikacameronmichaeladdisondaniellepenelope4thgradechristopherbuffalotrail

lesson 20- Sacagawea (4th Grade) 2024-01-19

20 Items: lumberpepperborrowthirtyattendcanyondangersoccerengineseldomeffortmillioncollectplasticsupportperfecttrafficfortunepicturesurvive

Lesson 27- Amphibian Alert (4th) 2024-03-18

20 Items: titletowelpedalmetaleagletotalmodelanklebattlesimplenickelgentlebarreltanglemarveljuggleriddlespecialtroublesquirrel

L12 Word Search - 4th Grade 2024-07-07

20 Items: goalslidecoachshownblownbrassswingsbecameviolinpasturelecturemixturemoisturepunctureadventuresculptureconductorliteraturepercussioninstruments

Hayden's Waves Word Search 2022-11-28

10 Items: areas of maximum displacementareas of maximum displacementfrequency is measured by hertzlocation of maximum displacement upa distance of one complete wave cyclelocation of maximum displacement downmeasurement of of maximum displacementa number of waves or vibrations per secondwave, moves the medium parallel to the wave motion...

Word Scramble 2022-11-15

40 Items: the ability to carry out a taskthe cost of operating a businessa natural ability to do somethinga business owned by a singular persona mental position with a fact or statethe worth or value of a good or servicemoney recieved on a regular basis for workNike is an example of an _____ (business type)the percentage of the industry's total revenues...

Birthday party July handsome and Roisin 2023-07-02

35 Items: hamginbbqbapscokecakesingbeerwinegoodnicefantacripssweetpepsimusicdrinkpartyrollspizzachipssaladburgermccoyspotatosausagechickenballoonscolaslowicecreambangeringchocolateporospccosausagerollscongratulations

Birthday party July handsome and Roisin 2023-07-02

38 Items: hamginbbqbapscokecakesingbeerwinegoodnicefantacripssweetpepsimusicdrinkpartyrollspizzachipssaladburgermccoyspotatosistersausagechickenfiamilybrotherballoonscolaslowicecreambangeringchocolateporospccosausagerollscongratulations

Birthday party July handsome and Roisin 2023-07-02

41 Items: hamginbbqbapscokecakesingbeerwinegoodnicefantacripssweetpepsimusicdrinkpartyrollspizzachipssaladkaiteburgermccoyspotatofamilysisterunlessauntiesausagechickenbrotherballoonscolaslowicecreambangeringchocolateporospccosausagerollscongratulations

Birthday party July handsome and Roisin 2023-07-02

45 Items: ginbbqMaryDavesingbeerwinegoodnicefoodloveGlennNiamhfantacripssweetpepsimusicdrinkpartyrollspizzachipssaladkaiteonionRoisinSeamusmccoyspotatofamilysisterunlessauntiecheeseCaitrinbrotherAishlinnSandwichPeasantsicecreamchocolateporospccosausagerollscongratulations

Kate's Sky Science Word Search 2023-12-18

20 Items: rocks in spacerederection of lighta belief about the starsthe galaxy where we livegroups of stars in the skyan object orbiting the suna human that travels to spaceanother way to say big dipperthe study of anything in spacewhen something gives off lightanother way to say little dipperwhen a rock safetly lands on earth...

8th grade Noah 2024-05-15

15 Items: Charging an object without touchingThe number of protons + the number of neutronsa material in which charges cannot easily moveThe number of protons. It is also the number of electrons.An unbalanced amount of positive charge and negative charge.An object with equal amounts of positive and negative charge...

PCR word search 2023-10-19

9 Items: the environment the DNA lives inusing heat;process modifying the molecular structure of a protein.one of the structural components, or building blocks, of DNA and RNA.to separate mixtures of DNA, RNA, or proteins according to molecular size.cooling;the process of joining of single-stranded DNA or RNA by hydrogen bonds...

Week 11 hard 2023-11-08

23 Items: winnerto worryurge to vomitfeeling relaxedthe guilty personable to do somethinga main branch of a treea false or mistaken ideathe removal of somethinglover of mankind; doer of goodwanting to know more about thingsthe season between summer and winterouter covering or sleeve for a letterthe hardest mineral on the Moh's scale...

Voices of Strength 2024-07-20

20 Items: legal entitlements.relating to the home or family.the right to express an opinion.action taken to improve a situation.the quality or state of being strong.public support for a cause or policy.a safe place for those escaping abuse.knowledge or perception of a situation.a condition of being safe or sheltered.the state of being free within society....

Hero's of Millennials 2023-01-31

19 Items: Actress and humanitarian.Comedian, actress, and writer.Actress, UN Women Goodwill AmbassadorMusician, actress, and philanthropist.Musician, actress, and philanthropist.COO of Facebook and best-selling author.Co-founder, chairman and CEO of Facebook.Musician, songwriter, and philanthropist.Media mogul, philanthropist, and producer....

Word Search - Elijah Smith 2023-09-12

31 Items: Moving airair that surrounds Earthtoo much water in one placeThe distance above sea levelHow hot or cold something isthe current outdoor conditionsbuilding up of something overtimeInformation that has been collectedThe amount of water vapor in the airthe continuous flow of water on earthwater water found in lakes and glaciers...

Random Words Game (July 2022) 2022-07-05

13 Items: okrbipoequityqualitybrownbagintegrityinnovationefficiencydatacentriccornerstoneatomeesbuzzpeoplecentriccustomercentric

LA 2023-10-25

21 Items: Poor balance and coordination:________Involuntary, uncontrolled movement:__________This type of spina bifida is the most severe:________Pre-, peri- or post-natal brain hypoxia:________ ________Velocity-dependent resistance to passive stretch:________Joint stiffness and deformity as a result of fetal akinesia...

Force and Motion 2023-11-27

20 Items: Unit of ForceA push or pullDistance over timeThe amount of matter in an objectDistance over time with a directionAn object's resistance to change in motionthe measurement of paths taken by an objectthe action or process of moving or being movedSpeeding up, slowing down, or changing direction...

Engineers Word Search 2023-01-17

26 Items: maintains and repairs x-ray equipmentengineering involved in all aspects of healthcareDevelop and design nuclear products and processesCoaster designs, builds and maintains amusement park rides.processes and analyzes LiDAR point clouds for anomalies and artifacts.improving the manufacturing process to increase the yield of products....

KVCS Zoology Week 1 Vocab Quiz 2023-09-02

20 Items: The study of plantsPlants that live for two yearsPlants that grow year after yearPlants that live for only one yeartype of adjective that modifies nounsFlowers that have both stamens and carpelsTakes the place of common and proper nounsA mature ovary that contains a seed or seedsFlowers that have either stamens or carpels, but not both...

We Will Rock You 2024-07-03

30 Items: Cruel and oppressive government or ruleFormal politeness and courtesy in behavior or speechNot subject to being taken away or transferred; inherentThe faculty or power of using one's will to make decisionsThe capacity to make informed, uncoerced decisions; self-governanceThe belief that free will and determinism are compatible and can coexist...

Mole Day 2023-10-23

10 Items: a mole is like a chemical '_____'a single unit of an ionic compoundthe mass of one mole of a substancea single unit of a covalent compounda unit used in chemistry to count particlesthe smallest particle of a substance that is not bondedthe scientist that the number 6.022x10^23 is named after...

Summer 2021-04-27

36 Items: FunIceFlipHulaJulyJumpropeJunePoolSnowparkBeachBikesflopsHoopscreamconesThemeMoviesSplashCampingFishingPartiesPicnicsCarnivalCookoutsParadiseSwimmingVacationFirefliesFireworksPopsiclesSunscreenSprinklersSunglassesRollercoaster

Summer 2021-04-27

36 Items: FunIceFlipHulaJulyJumpropeJunePoolSnowparkBeachBikesflopsHoopscreamconesThemeMoviesSplashCampingFishingPartiesPicnicsCarnivalCookoutsParadiseSwimmingVacationFirefliesFireworksPopsiclesSunscreenSprinklersSunglassesRollercoaster

Courthouse Word Search 2023-10-18

18 Items: Lying in courtPerson who is on the juryPromise to tell the truthAn expression of disapprovalLawyers examination before trialThe official decision of a courtRepresents the defendant in courtThe decision of a jury or a judgeAn invalid trail, caused by big errorA claim that someone has done somethingAsk a higher court to review a decision...

Korbin's word search 2022-11-28

10 Items: measured in meterstop point of the wavein a longitudinal wavebottom point of the wavearea of maximum displacementthe distance of one complete wave cyclethe measurement of maximum displacementmoves the medium parallel to the wave motionmoves the medium perpendicular to the wave motionnumber of waves or vibrations produced per second

Week 8 - Chapters 15 and 16 2024-07-19

20 Items: Double visionExcessive thirstExcessive hungerExcessive urinationPresence of glucose in urineElevated blood glucose levelsPrescence of ketones in urineOccuring in an abnormal positionAbnormally low blood glucose levelsAcidic molecules produced during fat metabolismGlands that secrete their products through ducts...

Saturn Word Search 2023-01-11

22 Items: moleculeWhat is "Sim"Moon of SaturnThe ringed planetGreek word for PhaseLiquid in Titan's lakeSpanish word for PhaseMethane is made of theseObserve with the naked eyeHelped Robert Boyle to measure air!How the appearance of a substance changesWhen either one goes up the other goes downHas no visible shape and fills its container....

Planets 2022-05-31

15 Items: Our planetAn icy planetThe red planetOrbits our planetThe brightest starOur is the Milky WayThe planet with ringsDemoted from a planetOld number of planetsGod of the Sea's planetGoddess of Love's planetThe planet closest to the sunCurrent official number of planetsThe largest planet in our solar system...

Forensic Science recap 2023-12-20

19 Items: cone-bearing plantsfiber from coconutsthe flowering plantsrelates to after deathstudy of pollen and sporesfiber made from rabbit hairevidence that implies factshaving to do with your stomachpart of hair that contains DNAtype of cuticle found in humansnot allowed as evidence in courtfiber that can cause lung issueswhat plant cell walls are made of...

Brooke's Word Search 2022-11-28

10 Items: areas of maximum displacementareas of maximum displacementnumber of waves or vibrationswhat a frequency is measured inlowest part of a transverse wavehighest part of a transverse wavewave moves the medium perpendicularmeasurement of maximum displacementthe distance of one complete wave cyclemotion that is parallel to wave direction

Early European Exploration 2022-09-09

19 Items: to treat someone unfairlysedimentary rock used to make toolsa territory or state ruled by a chiefa settlement ruled by a distant countrythe average person in Mississippian societya competition for the same objective or itemthe people that held power in Mississippian societythe swamp the many native americans tribes lived in...

Qualitative Research 2024-07-09

10 Items: The consistency of a research study or measuring testRecurring patterns or topics found within qualitative data.The process of categorizing and assigning themes to qualitative data.A method of collecting data through direct questioning of participants.A research approach that seeks to understand individuals' lived experiences...

4th Grade Unit 6 Review 2013-09-30

50 Items: knitknowsignwrencarescrubclimbkneelwreckbrakecoverphotoroughsnacktrackdriedscreamscreensquaresquealsquirtstreetthrillassigndesignwreathwrenchattackenoughKansaspocketdancedscratchsqueezethroughunknownwritingbecausedolphinopeningworriedalphabetelephantstoppingstudyingworryingscariestsmallestskyscraperstrawberry

Mrs. Primo's 4th Grade Class 2023-08-20

22 Items: elinikoliammilanambermasonmariaameliazaydentaziirlorenasharonmahniyabrinleypaisleeemanuelmadysonvenechiojennifermarielosfelicityalexander

IMPOSSIBLE 4th Grade Word Search 2024-04-03

58 Items: elibenleahnoragigiavenlolaailimilomacyrhysjesusmariajackbrowanmilescallijacklgrantleynaliamvesterbaronhenrylydialiamsjacksadrienaliviacoltonhuxleycarterethanwameliacallensophieaustinalijahmarlieteaganjohnnyclairehenleyethansmadalynkennedypaisleygriffinnovaleemichaelmadelynpastorkdeverauxmakenziemackenziemrsreimermrspackardwillythewildcat

L12 Spelling Words - 4th Grade 2024-04-30

20 Items: goalslidecoachshownblownbrassswingsbecameviolinpasturelecturemixturemoisturepunctureadventuresculptureconductorliteraturepercussioninstruments

L4 Word Search - 4th Grade 2024-07-07

20 Items: quiztodaypupilnasaltwelveacrossduringsimilebridaldentalgerbilpostalproverbpassagepioneermetaphorproposalimmigranthemispherepopulation

Mrs. Hipp's 4th grade kiddos 2024-07-26

21 Items: lukejackleviowenlaceylaylaelenakimmymicahaidencolinhenryharperbettiecooperarthurfultonclemmiebradleycharlottehippenmeyer

Word Search 2022-11-13

20 Items: Wry neckSkin-peelingEye prophylaxisPale color of skinFanning of the toesSluggish blood flowAccumulation of bloodAssesses gestational ageThin, slimy, more wateryDisappears at 12-18 monthsHeat loss via indirect contactInability to control temperatureMovement of the involved extremityGlistening cysts on the hard palate...

Find the Government Vocab! 2024-01-25

15 Items: The highest federal court in the United States.Employment in government positions based on merit.The power of courts to declare laws unconstitutional.The general trial courts in the U.S. federal court system.Presidential act forgiving a person of their federal crime.A practice of giving government jobs to political supporters....

cou 2024-04-25

20 Items: FasochadbeninVerdeegyptgabonangolaGuineaalgeriaburundicomoroseritreabotswanacameroondjiboutiethiopiaof the Congo(formerly Swaziland)African Republic (CAR)Republic of the Congo (DRC)

Weather and Climate 2023-05-12

15 Items: Warm water currentchange in moister contentmeasures the air pressuremeasures the speed of windwarm air that rises rapidlyusually brings precipitationmeasures the direction of blowing windthe weight of air pushing down on earthmeasures the amount of heat in the atmospherewhen the boundary between two air masses stalls...

The Dating Game Killer 2022-12-14

10 Items: Lamb19791970sSamsoeCrilleyBarcomb24, 2021ParenteauRuth Thorntondating game killer

European Capitals 2022-12-07

11 Items: oslolondontallinmadridwarsawhelsinkistockholmCity of lightWhere the Parthenon temple isThe city of Mozart and Gustav KlimtWhere the statue of little mermaid is

cases word search 2022-11-28

10 Items: lowest point of a wavehighest point of a wavewhat frequency is measured inmeasure of maximum displacementdistance of one complete wave cyclethe number of vibrations per secondmoves medium parallel to a wave motionmoves the medium perpendicular to a wave motionarea of maximum displacement in longitudinal wave...

Vada's Word Search 2022-11-28

10 Items: area of maximum displacementarea of maximum displacementthe wavelength measured in meterslocation of maximum displacement uplocation of maximum displacement downthe distance of one complete wave cyclethe measurement of maximum displacementnumber of waves or vibrations per secondmoves the medium parallel to the wave motion...

Week 11 easy 2023-11-08

24 Items: winnerto worryurge to vomitfeeling relaxedthe guilty personable to do somethinginventive, imaginativea main branch of a treea false or mistaken ideathe removal of somethinglover of mankind; doer of goodwanting to know more about thingsthe season between summer and winterouter covering or sleeve for a letterthe hardest mineral on the Moh's scale...

Kenzie's Science Wordsearch 2023-12-18

20 Items: Is earths GalaxyA group of stars making a shapeIt must be big and orbit a starA path that a planet is stuck inThey study of everything in spaceWhen light bounces off the objectA piece of rock floating in spaceDischarged gas air and other stuffA rock that enters earths atmosphereBelief of that signs tell our personality...

The weather and the seasons 2021-05-26

39 Items: MayhotwetdryicyJuneJulywarmcoldcoolMarchAprilsunnywindysnowyrainyfoggytodayspringsummerautumnwinterAuguststormycloudyJanuaryOctoberthundershoweryrainbowFebruaryNovemberDecemberfreezingtomorrowSeptemberlightningyesterdaytemperature

English vocabulary 2022-06-13

39 Items: maysadonetwotenjunejulyfourfiveninemarchaprilhappytiredthreeseveneightwindysunnysnowyrainyfoggymondayfridaysundayaugustwintersummerautumneleventwelvestormytuesdayjanuarythursdaysaturdayfebruarywednesdayseptember

WAY OUT THERE in SPACE 2024-03-01

34 Items: We live on itThe Blue PlanetNow a dwarf planetToo large to handleAir surrounding earthShe's too hot to handleConsidered the red planetGives warmth to the earthStreaks of light in the skyThe name always sounds funnyThe solid outer part of earthThe only planet that can floatThe region surrounding the SunBrightly colored bands of light...

ANATOMY OF A HORSE 2024-01-18

15 Items: A horse’s front foot.The left-hand side of a horse.The right-hand side of a horse.The ridge between the shoulder blades.The topline of a horse’s hindquarters.The ridge between the shoulder blades.The hair that grows from a horse’s neck.This is the bone located inside the hoof.The joint above the pastern functions like an ankle....

Passover 2024-03-03

15 Items: A SACRED RELATIONSHIP WITH GODA CELEBRATION OF AN IMPORTATNT PAST EVENTTHE NATION THAT GOD CHOSE TO BE HIS PEOPLEA SERIES OF DISASTERS GOD BROUGHT UPON EGYPTTHE WORDS OF JESUS THE PRIEST REPEATS AT MASSTHE BREAD GOD GAVE THE ISRAELITES IN THE DESERTA MEMORIAL MEAL RECALLING THE EXODUS FROM EGYPTAN ISRAELITE GOD CHOSE TO SAVE ISRAEL FROM SLAVERY...