4th of july Word Searches

Unit 3: Electrons in Atoms 2023-09-26

20 Items: 3.00 x 10^8 m/sHeight of a waveparticles of lightthe arrangement of electrons in an atomElectrons on the outermost energy level of an atomthe clockwise or counterclockwise motion of an electronthe possible energies that electrons in an atom can havenumber of complete wavelengths that pass a point in a given time...

Epidemiology Topic 3 2023-01-28

12 Items: S____ maps show locations of individual cases.Descriptive epidemiology enables development of testable h__________.Cross-sectional allows measure of the p________ of something(e.g. a disease).Descriptive epidemiology provides information useful for a_________ of resources....

Lesson D Reading Word Search 2023-11-15

16 Items: the action or practice of meditating.the accomplishment of an aim or purpose.a feeling of worry, nervousness, or unease.the state of being free from injury or illness.the state of being comfortable, healthy, or happy.focus a persons attention on a particular activity.to have optimistic, affirmative, and good feelings....

PSG Scoring and Event Quiz 1 2024-04-23

22 Items: teeth grindingirregular heartbeat>90% drop in airflowrapid cycling P waves>10 mmHg increase in PaCO2heart rate >90 BPM during sleep>3 second pause(6+ years of age)<40 BPM during sleep (6+ years of age)30 sec for staging, 120 sec for scoringSleep ____ distribution of sleep stages_____ rhythms the body's natural clocks...

modern history 2023-07-17

20 Items: 1918 CE: The end of _____ _____ _.1904 CE: The Russo- _____ War begins.1933 CE: Adolf Hitler became the Chancellor of _____.1925 CE: Benito _____ gains dictatorial powers in Italy.1925 CE: Hitler's autobiography, ____ _____ is published.1928 CE: _____ _____ was created at the Walt Disney Studio....

Slappy Word Search 2024-07-22

20 Items: NightZombiesBeware!of a Dummyof the Jack!in DreamlandFriend SlappyBlood Is Backand the Beastwith the StarsBirthday to YouGhost of Slappyof the SquawkerAlive! It's Alive!from Shudder Mansionof the Invisible BoyAm Slappy's Evil TwinDo Not Feed the WeirdoDummy Meets the Mummy!Call Me the Night Howler!

Kaylee Word Search 2022-10-05

29 Items: MANmosslovenavyROOMCLAYmarchblushkayleehunterturkeyfamilyweddinghuntingcupcakesOF HONORSECURITYsaturdayburgundyhoneymoontennesseeflowergirlDIXIE FARMSOF THE BRIDEOF THE BRIDEOF THE GROOMOF THE GROOMWAY FOR MOSSLAUREN PHOTOGRAPHY

Mitosis 2023-02-21

17 Items: The life of a cell.Two Identical Cells.The last phase of mitosis.The second stage of meiosisThe first stage in cell division.An organism of one or more cells.The process by which a cell divides.Division of the cytoplasm of a cell.To repeat or copy (something) exactly.The process in reproduction and growth cells....

The Nervous System :) 2024-02-21

15 Items: - the largest lobe of the brain- the sensory switchboard of the brain- part of the brain that controls breathing- part of the brain that coordinates movement- part of the brain in charge of memory and hearing- a disorder of the brain characterized by repeated seizures- part of the body that receives and sends sensory information...

SIX THE MUSICAL 2023-03-15

17 Items: sixWAYPARRDOWNbradWIVESBOLEYNposadaSEYMOUROF STONEcatherineOF CLEVESkatherineOF HOLBEINLOSE UR HEADYOUR WANNA DODON'T NEED YOUR LOVE

SPELLING 4th grade 2015-09-15

12 Items: dealleadagreebriefchieffieldpeachpiecesteamseasonbelievebetween

Revision 4th grade 2022-09-04

12 Items: basketpolitecinematraveldriveranswerpenguinlanguagefireworksyesterdayespeciallybasketball

Purcom Set 1 word puzzle 2022-12-15

25 Items: Full command in 2 languages.The most famous dead language."What are they talking about?"Sender gives a message to whom?Hearing things through language.Order is issued through language.The Latin word for "communication""meaning are in people, not words"Obstructs exchange of communication.Responses to the messages of the sender....

U6 Vocab 2023-11-09

36 Items: A seasonal wind.the coldest climateThe climate of a small area3rd layer of the atmosphereWinds that blow from west to eastThe lowest layer of Earth's atmosphereA thin layer of gases surrounding Earthwhen a cold front overtakes a warm frontThe outermost layer of Earth's atmosphere.A person who studies the different climates....

Biology Chapter 11 Vocabulary Word Search 2024-03-19

25 Items: formation of a new speciesthe variety of alleles in a populationthe changes in a population's genetic structurethe effect of chance on a population's gene poola speciation that occurs via a geographic separationa speciation that occurs in the same geographic spacean evolution that results in similar forms on different species...

EASTER 2023-04-03

32 Items: funjulyjunepoolbeachbikesaugustmoviessplashcampimgfishingparadespartiespicnicssandalscarnivalcookoutsicecreamjumpropeswimmingvacationfirefliesfireworksflipflopshulahoopspopsiclessprinklersnowconessunscreenthemeparksunglassesrollercoaster

sjeioshreoishresiorhesfnkajkfnjkfnasjkdnajkda 2023-07-08

32 Items: funcakelovewifejulybridegroomdressdancetoastkatieitalytuxedochapelcheersfamilydrinksaustinweddingfriendshusbandvermontcollegememoriesmarriagemountainhoneymooncelebratesaintmikesburlingtonislelamottelakechamplain

NervousPathology-Pugh 2022-08-15

15 Items: parkinsons is onebundles of neuronspathway to the CNSpathway from the CNSan involuntary responsefound at nerve synapsessomething affected by ADHDan actual use of medical detoxF of stroke symptom screening FASTA of stroke symptom screening FASTS of stroke symptom screening FASTT of stroke symptom screening FAST...

Wordsearch 2023-03-29

15 Items: The age of LeBron.The shop LeBron owns.The height of LeBron.The daughter of LeBron.The net worth of LeBronThe first son of LeBron.The second son of LeBron.The name of LeBron's wife.The school owned by LeBron.The city LeBron was born in.The month LeBron was born in.The high school LeBron went to.The American state LeBron was born in....

Ian and Liz OO 2024-05-28

29 Items: Groom's sisterMonth Ian proposedBride's professionGroom's professionHen party locationWhere Ian proposedBride's middle nameGroom's middle nameMonth they first metBride's brother's nameGroom's favourite hobbyThe couple's dog's nameCouple's favourite monthThe club they are part ofMother of the groom's nameMother of the bride's name...

ES 2.1 Gravity and the Universe 2022-10-10

15 Items: our galaxytype of meteoritegroups of galaxiesone of 3 types of known galaxiesone of 3 types of known galaxiesone of 3 types of known galaxiesa rotating cloud of gas, ice and dustapproximate shape of ALL known galaxiespiece of a meteoroid that lands on Earthatoms move more quickly when they are __________...

Chemistry, Physics, and Energy 2023-05-14

20 Items: measured in Newtonsmeasured in mL or cm^3they make up the periodic tablemetals are good examples of thesethe first step in the water cyclethe formula for it is mass/volumeplastics are good examples of thesethe formula for it is distance/timea phase change, the opposite of depositionthere are two types of it-positive and negative...

ELA Word Search 2024-01-08

26 Items: Time orderExtreme exaggerationThe problem of a storyPerson telling the storyGood guy or hero of a storyOpposition's claim/argumentTo restate in your own wordsSequence of events in a storyBad guy or villain of a storyA word with a similar meaningThe time and place of a storyConversation between charactersMain idea of a text (two words)...

Atom Word Search 2023-10-19

15 Items: smallest part of matterthe quality or condition of being hardthe process of turning from liquid into vapora naturally occurring inorganic element or compoundelating to or denoting compounds which are not organica thing that is composed of two or more separate elementphysical substance in general, as distinct from mind and spirit...

Mrs. Ellison's Favorite Things 2014-01-13

30 Items: JuneJulypensHGTVObamaBibleAugustFamilyCivicshikingbikingreadingHiaasenLincolnfreedomHistoryfriendsAmericaUofMiamiteachingchocolateCharlestoncleanjokesJonStewartJimmyFallonWillaCatherWashingtonDCCarverMiddleshrimpandgritsFrederickDouglass

Independence Day - Word Search 2023-07-03

30 Items: redblueflagjulywhitefamilyfourthnationparadepicnicrightsstatessummerunitedamericafreedomholidaylibertystripesbarbecuecoloniescongressequalitythirteenfireworkspatrioticrevolutioncelebrationdeclarationindependence

ellies wordsearch 2023-12-18

16 Items: to create lighta pattern of starsthe study of planetshas the north star in itfor light to bounse of itthe study of constellationsa rock that falls from spacea person that travels in spacea spoon made of made of 7 starslight in the sky from a meteoroidapath in space around a planet/starwhen night and day are the same length...

Spanish Vocab 2 2022-10-06

33 Items: penmaybookjunejulytodaymarchaprilfolderpencilmondayfridaysundayAugusttuesdayjanuaryoctobernotebooktomorrowthursdaysaturdayfebruarynovemberdecemberclassroomwednesdayseptemberstudent deskstudent (male)sheet of paperteacher (male)student (female)teacher (female)

World Landmarks 2023-02-10

20 Items: BenTowerMahaluluruFallsSophiaMosqueMosqueMosqueAlHaramKhalifaAnNabawicolosseumof Libertyof CordobaOpera HouseGate BridgeBlue MosqueLane MosqueWall of China

Cells Word Search 2024-05-21

15 Items: the smallest unit that can live on its own.provide support and movement to the soft tissues.a type of fibrous connective tissue that links your muscles and bonesA type of blood cell that is made in the bone marrow and found in the blood.a type of eukaryotic cell that lacks a cell wall and has a membrane-bound nucleus...

2nd year Word Search 2023-12-28

31 Items: mayteajunejulymarchaprillunchmondayfridaysundayaugustspringsummerautumnwinterdinnersupperbrunchtuesdayjanuaryoctoberholidaythursdaysaturdayfebruarynovemberdecemberbirthdaywednesdayseptemberbreakfast

Baluster Word Search 2023-02-24

25 Items: a fence or barrier made of rails.a short pillar or column on stairsthe lower square slab at the base of a column.a horizontal beam connecting two rafters in a roofa window that projects vertically from a sloping roof.move from a lower position to a higher one, come or go up.a side post or surface of a doorway, window, or fireplace....

Baluster Word Search 2023-02-24

25 Items: a fence or barrier made of rails.a short pillar or column on stairsthe lower square slab at the base of a column.a horizontal beam connecting two rafters in a roofa window that projects vertically from a sloping roof.move from a lower position to a higher one, come or go up.a side post or surface of a doorway, window, or fireplace....

4th Grade List #20 2023-01-05

16 Items: jacketfatherkingdompumpkindolphinfartherlobsterinspectathletewhetherinstantchildrencompletepurchasesandwichcomplain

Hammurabi Word Search 2023-09-01

20 Items: an ancient manuscript text in book form.In Hindu belief, a person's religious and moral dutiesan official order or proclamation issued by a person in authoritythe belief that people were bad by nature and needed to be controlleda king of ancient Egypt, considered a god as well as a political leader...

Ancient Egypt Terms 2022-08-09

20 Items: The capital city of the Old Kingdom of Egypt.A large stone box that held a mummy's coffin.A queen of Egypt who was famous for her beauty.The season of the year when the Nile river flooded.A charm worn that the Ancient Egyptians thought had magical powers.A powerful queen who became one of Egypt's most successful pharaohs....

Acceleration Word Search 2023-10-06

26 Items: the size or quantity of somethingunit of measurement for force (N)push suddenly in a specific directionthe repetition of a process or utterancea quantity that has both magnitude and directionForce the sum of all the forces acting on an objecta push or pull that can change the motion of an object...

Term 4 Review 2022-10-05

13 Items: a text typeHuman _____an IB attributeanother text typean English B themeanother IB attributeanother English B themepart of the core of the DPthe number of IB attributesthe number of English B themesanother part of the core of the DPa strategy for reading comprehensionanother strategy for reading comprehension

ww4 u8 2024-04-29

15 Items: a roomto finda way invery valuableto go or come downhaving lots of roomthe outside layer, the topvery old; of a long time agothe inside part of somethinga part or share of the wholea period of one hundred yearsa part of a written work or piece of musicto come or go in without permission or welcomea deep pit where stone is cut out of the ground...

Astronomy Word Search 2023-12-18

21 Items: emitorbitmilkymeteorplanetgalaxyequinoxreflectsolsticemeteoriteursamajorursaminormeteoroidsa constellationa constellationthe research of the skya group of stars in the skythe start of summer or winterthe research of bodies in the skyfrozen leftovers in the solar systema person that flies into space to do research in space

Classic Horror Movies 2022-10-20

15 Items: ManManblobkongmummyof waxpeopledraculanosferatufrankensteinof the operadangerous gameon haunted hillof Frankenstein"from the Black Lagoon

Mexico's Culture 2024-05-09

12 Items: an example of Mexican artofficial name of our countryan example of a Mexican sportofficial language of our countryscientists who study human cultureculture can change when the ___________ changesan example of a thing/element that makes up a cultureanother example of a thing/element that makes up a culture...

By-Election Losers since 2019 2023-10-31

19 Items: with envyKleptomaniacson of Patrickadept at making barrelsTiger in the Jungle Book1996 Formula One Championthe groover from vancouverVs Lion and nearly a Turkeya typical teenager's bedroomdamaged the governor's districtput undergarment in the rubbishtaking the courage out of the camelshortest reigning Monarch of England...

GIFTS OF THE HOLY SPIRIT 2023-06-23

9 Items: faithhealingmiraclesprophecyof wisdomof spiritsof tonguesof knowledgekinds of tongues

Macroeconomics Wordsearch 2024-04-24

14 Items: total amount gainedassets of a businessCreator of Capitalismthe amount of a productthe makers of a productthe buyers of a productwant of a certain productfounder of a new businessa greater demand than supplyamount gained after all expensesthe current price a product is sold atwhen a business fights another for customers...

Matariki- The Maori New Year 2024-06-20

32 Items: newfoodjunejulytreeyearsevenstarsmaorisongslightmusicnightgamessongsfamilynaturepublicfridaywintersistersclusterfriendscultureholidayoutsidematarikipresentsaotearoahandmadeimportantcelebration

Unit 8 APES review 2024-04-30

20 Items: Where over 50% of MSW ends upA common exposure route through the airA common exposure route through the skinA common exposure route through food/ waterIncrease in death rate occurs over a large areaType of waste that is mostly chemical and constructionType of disease not caused by pathogens and can be genetic...

chapter 2 - tools of environmental science 2023-09-06

17 Items: factor of interestchance that something will happen.representations of objects or systems.the probability of an unwanted outcome.associations between two or more events.a procedure designed to test a hypothesisgroup that receives the experimental treatmenta piece of information we gather using our senses...

Birthday month 2023-02-07

32 Items: fryjunejulyyearhometimegoodweekcokemarymarsdavebluemarchclassfantapepsiaugustoctberdinnerfamilyfriendjanuaryholidayweekendfebruarynovemberdecemberbirthdayhospatilshoppingseptember

LGAW Crossword 2024-02-28

18 Items: The Tla'amin Nation NewsletterElected Executive Head of the Tla'amin Nation.How staff present information to elected officialsElected Executive Head of the City of Powell River.The name of elected officials for the Tla'amin NationCampsite and Park managed by the City of Powell River.Elected Executive head of the qathet Regional District....

Conduction Word Search 2024-05-16

15 Items: Ice melting in your handwhat is the charge of Cswhat is the charge of Srwhat is the charge of Sewhat is the symbol for Goldwhat is the symbol for radiumwhat is the combination of H+Ohow many electrons are in Goldwhat is the symbol for Hydrogenwhat is the combination of AI+Pwhat is the combination of Ca+Owhat is the melting point of iron...

4th quarter at school 2017-03-27

18 Items: WinPushTestsFocusStudyFinishStrongGradesSummerSportsRewardStriveFreedomClassesBehaviorSwimmingStrategyConsequence

4th Grade Week 2 2022-08-30

18 Items: wherewatchtheseworthattachchangesingerspringgatherthreadawhileathletethirstywhisperwhistlenowheresandwichslippery

English Law Word Search 2023-09-13

25 Items: Dealt with major civil casesWrote the first Law Code of EnglandA systematic collection of statutes.A written law passed by a legislative bodyA difficult or painful experience, a trialA court of equity, as distinguished from a common-law court.A legal document giving certain rights to a person or company...

Agency Administration 2021-04-22

19 Items: BeatZoneSectorBriberyPerjuryPrecinctMoochingShoppingChiselingShakedownExtortionCorruptionMeat-EaterFavoritismGrass-EaterRank-StructureCode-of-EthicsUnity-of-CommandOperational-Strategies

Unit 7 Medical Insurance and Coding 2019-10-22

30 Items: plancaregroupschargewaiverlimitedmanagedmedigapmedicaremedicaidindemnityinsuranceco-paymentdeductiblegatekeeperindividualcoinsuranceout-of-areacoordinationfee-scheduleeffective-datefee-disclosurepatient-statesgroup-insurancemember-providerdiagnosis-relatedmedicare-fee-scheduleparticipating-providerexplanation-of-benefitsloss-of-income-benifits

Science Vocab Chapter 5 2024-01-16

14 Items: The SI base unit of thermodynamic temperature.The degree or intensity of heat present in a substance or object.A substance which doesn't readily allow the passage of heat or sound.The transfer of thermal energy from one physical system to another system.A natural process of heat transfer involving the movement of energy from one place to another....

CH6 - Human Impact 2022-12-20

16 Items: Pollutants that are released into the air.________________________Contamination of Earth's land, water, or air.________________________A specific source of pollution that can be identified.________________________The removal of forests to use the land for other reasons.________________________...

HAPPY 4th BIRTHDAY ALINA 2022-12-15

15 Items: funredfourbluepinkalinapartygreencanvasfamilycolorspurpleyelloworangefriends

Compact Word Search 2023-10-06

11 Items: a compact's usual shapea synonym of compactingwhat a compact can carryan antonym of compactingtype of makeup that boldens lipstype of makeup that tans your facetype of makeup that boldens eyelashestype of makeup that colors your eyelidssomething to apply powder onto your facetype of makeup that makes your cheeks rosey...

Nindita, Maisya & Shofia Riddle 2023-02-23

25 Items: : separating the room: another name for loft: vertical height in stairs: the bottom part of the door: a very common type flooring: different levels of building: the bottom part of the window: highest level in the apartment: the lowest load-bearing part of building: the top element that covering the building...

Math 6 Vocabulary 2023-04-18

15 Items: Part of a wholePer one hundredA comparison of two ratiosA comparison of two quantitiesThe measurement of the space aPositive or Negative Whole NumberA statement of an order relationshipA math statement that shows equalityThe measure around the outside of a circleThe measurement of the outside of a polygonMath phrase with numbers and operation sign...

Chapter 4 Word Search 2023-11-16

34 Items: Organelle of protein synthesis.Viscous fluid enclosed by the nuclear envelope.Small circle of DNA in some bacteria and archaea.Long, slender cellular structure used for motility.Barrel-shaped organelle from which microtubules grow.This eukaryotic organelle specializes in producing ATP.Semifluid substance enclosed by a cell's plasma membrane....

Summer 2020-06-16

33 Items: hoticesunswimhikewalkJuneJulypoolplayroadhatsbeachsunnycreamoceanbikesparksrelaxtripsAugustcampingpicnicsglassescookoutsbaseballoutdoorspopsiclevacationbirthdaysflipflopssunscreenthunderstorms

A Tale of Two Cities 2024-05-10

26 Items: trotspilllumberrelishburiedinformshatterimaginedeliverentertainconstituteThe Shoemakerthe Golden Threadverbs found in ATOTCOwner of the wine shopthe mysterious messengerBanker from Tellson's BankTom's guard on the mail coachRecalled to this______________London and Paris are 2 of thesethe destination of the mail coach...

Carbondioxide Word Search 2024-05-16

15 Items: Produces Atphas a formula of C6H12O6The site of Photosynthesissingle member of a speciesHas a chemical formula of CO2when a liquid turns into a gaswhen a gas turns into a liquidwhen water is released from the cloudsliquid that fills up the inside of a cellConverts light energy into chemical energyall the living and non living things in an area...

Greta's Planet Wordsearch! 2023-12-18

20 Items: our galaxygives off lightwhen light bounces offsomething orbiting the sunMajor Latin name for big bearChris Hadfeild is one of theseA big ball of ice gas and rocka piece of rock still in spaceminor latin name for little beara group of stars making a picturea constellation making a big beara constellation making a little bear...

Chapter 15 Vocabulary Review 2024-03-06

34 Items: A brand that can be spokenThe overall perception of a brandLines of transport owned by shippersThe sum of related individual product itemsA distribution system without intermediariesA brand that cannot be spoken; a company logoThe collection of a firm’s total product linesThe similarity of product lines in a product mix...

June 5-11 2023-05-13

24 Items: joylifeloveseeknisanfriendwisdomloyaltyhonestyjehovahprosperinherittogetherhezekiahpassoverhumilityholinessmarriagegatheringjerusalemof jehovahmotivationneutralityof Unleavened Bread

Units 44 and 45 Part 2 2024-01-18

62 Items: votedpublicnationalby votingto be sent(color) silver(color) copper(neuter) the wood(neuter) the metal(feminine) the voteof or made of glassof or made of plastic(feminine) the revolutionwooden, of or made of wood(feminine) the (law) treatyof or made of stone or rock(neuter) the (rock) diamond(masculine) the (male) slaveof or made of metal, metallic...

Unit 5: Spelling Lesson 1 2023-01-12

25 Items: composed of onefoolish or sillyan eating establishmentcomposed of more than onea shortened form of a wordslanted cursive or type characterscomprising everything; comprehensiveconsisting of diverse things or membershappening as a minor result or by chancethat which had being before something elseuninfluenced by emotion; based on the factual...

Shelach 2024-06-22

18 Items: “Send”Shalom“Fallen ones”Ammiel’s father.“The Ninth of Av”a cluster of grapes“In the Wilderness”Where Moses sent the scouts.The Master’s “Sent Out” onesThe city Moses bequeathed to CalebHoshea son of Nun was from this tribeSon of Hori, from the tribe of Simeon.He sends out spies in the Haftarah Shelach.Caleb, son of Jephunneh was from this tribe....

Challenger - Comet Vocabulary ALL - Word Search 2023-05-16

30 Items: The compactness of an object.To move in a circle or orbit around.The seven colors that make up white light.The title of elected US government officials.A group of stars that form a picture or a shape.The action of rotating around an axis or center.A comet that orbits the Sun in less than 200 years....

Roisin Niamh Griffin wedding 2023-02-24

31 Items: cakedatesuitkisswinesingfoodringtacojulyphotomusicdrinkdancehappyenjoypizzapeopleflowerinvitefamilyfriendsistersausagebrotherbestmenchickensandwichtoptableseweddingbellweddingdresses

Birthday party mother 2023-03-21

31 Items: boywkdbeercakecokegirljunejulylovewinefantapepsimusicchrissweetmarchaprilpeopledrinksfamilysisterinviteauntiesummerballoonbrothersausagechickenjanuarybirthdayfavourite

Bastille day. 2022-11-29

7 Items: dayJuly.freedomlibertyequalityaniversary.enemie du peuple.

Metric Measurements 2022-08-17

19 Items: masskilodecadecihectoUnitscentimillilengthconversiondisplacementgraduatedcylinderthe unit of volumethe unit of distancethe unit of weight/massis smaller than centimetersis the amount of space an object takes upare one thousand times larger than a gramis the unit in between a kilometer and a decameter

Mr Richie 4th Grade 2020-12-09

17 Items: EvaJoseTRexDavidIssacJaydenFrankieAmongusVictriapJonathanImpostorAlexandraVictoriamAdventureDinosaursCretaceousGrandCanyon

Country 2023-04-29

10 Items: ItzaMahalpetraPicchuof Gizacolosseumof Libertystonehengethe RedeemerWall of China

Baluster Word Search 2023-02-24

25 Items: a fence or barrier made of rails.a short pillar or column on stairsthe lower square slab at the base of a column.a horizontal beam connecting two rafters in a roofa window that projects vertically from a sloping roof.move from a lower position to a higher one, come or go up.a side post or surface of a doorway, window, or fireplace....

Mr. Frederick Unit 2 Word Search 3 2024-01-11

40 Items: Joe BidenexpressedKamala Harrismade by Congressmeans set aside for.means assigned or given.lowest level of governmentHighest level of GovernmentEach state receives 2 votesgave englishmen a free elcectionAct of giving a business licensebranch with a congress to make laws.branch with courts to interpret laws.chamber of congress at the state level...

Birthday Boy 2023-02-13

25 Items: benuvahubryanjakejulygolfjuliaemilydennyHeelssauceStreetfamilycuisinesouthernfootballCarolinabusinesscolthurstrestaurantfraternitybasketballhospitalitytwenty-third

Plate Tectonics: 4.01-4.02 Vocabulary 2022-11-18

12 Items: CAPABLE OF BEING MOLDEDCAPABLE OF BEING MOLDEDTHE OUTERMOST LAYER OF EARTHTHE UPPER PART OF EARTH'S MANTLEUPPER MANTLE JUST BELOW LITHOSPHERESOLID IRON AND NICKEL LAYER OF EARTHTYPE OF CRUST THAT IS DENSE AND THINLIQUID IRON AND NICKEL LAYER OF EARTHTYPE OF CRUST THAT IS THICK AND LIGHTPART OF EARTH BENEATH THE CRUST MADE UP OF ROCK...

Meiosis 2024-05-31

17 Items: period between two periods of mitosishaving chromosomes in homologous pairsa period in the life of the cell when it is conducting cell divisiona condition in which non-sister chromatids of homologous chromosomes exchange geneshaving a single, complete set of chromosomes, or one half of each pair of homologous chromosomes...

Admin key term word search chapter 1 2022-12-14

21 Items: cmarmarmaaamamshposhaabheshipaacaahepresumeclia'88registrationaccreditationcertificationcross-trainingstandard-of-carepatient-navigatorscope-of-practicecontinuing-educationlicensed-practitionerprofessional-development

Foundation Word Search 2022-09-16

25 Items: the lower edges of a roofto support the roof ceilingThe inclined member of staircombination of tread and riserto give support to the handrailthe bottom horizontal member of athe inclined rail over the stringextend from the caves to the ridgecovers the top face of the buildingone that allows fresh air and lightthe surface laid on the plinth level...

Parts of a Song 2024-02-16

16 Items: the speed of the music; BPMthe "first paragraph" of a songthe musical structure of a songform that is verse, chorus, versethe words in the song; expresses emotionthe sense ("feel") of an insistent rhythmform that is verse, chorus, verse, bridgemost 3-pointers made in one NBA game (14)strong, regular, repeated pattern of beats...

Chinese Rulers, Dynasties, and Philosophers 2023-09-28

18 Items: The Shortest DynastyThe Last Dynasty of ChinaThe Last Emperor of ChinaThe First Emperor of ChinaThe First Dynasty in ChinaThe Longest Lasting DynastyThe Philosopher who Wrote The AnalectsBorn as a Peasant, but Became an EmperorA Philosopher Who Wrote "The Art of War"The Emperor Who Started the First DynastyThe Dynasty that was Founded in 202 B.C.E....

Science definitions 2023-05-15

16 Items: measures air pressurechanges moisture contentweight of air pushing down on eartha tropical storm with winds exceeding 119 km/hrmeasures the amount of precipitation that has fallena front where cold air mass replaces a warm air massoccurs when a cold air mass takes over a warm air massfront that stays in one place for a long period of time...

Science definitions 2023-05-15

16 Items: measures air pressurechanges moisture contentweight of air pushing down on eartha tropical storm with winds exceeding 119 km/hrmeasures the amount of precipitation that has fallena front where cold air mass replaces a warm air massoccurs when a cold air mass takes over a warm air massfront that stays in one place for a long period of time...

Sensory Organs & PNS 2022-10-03

31 Items: ear waxsense of smellnearsightednessear inflammationinability to hearnoise in the earseyelid inflammationanother word for styhardening of the earpertaining to hearingcapable of being heardanother word for cryingsmall dark circle in eyeabnormal pressure in eyemucous membrane of eyelidsurgical repair of ptosisanother word for lazy eye...

Magic Joy 5 2023-11-16

32 Items: busysoupjulyricebeeflatefishcombhairwalkbreadearlysteakfirstaprilfifthdirtymarchaugustalwaysdishesschooloctoberjanuarysciencenoodleschickenchineselibraryexercisedecemberdumplings

long I sound 2024-03-18

32 Items: cryfrydrypietiebikepinesighjulytinytypeideagridvinecrimelightfightrightchildpilotfriedstylerhymeslidesquidweightspiderfreighteighteenneighbourintelligentinsignificant

Step Word Search 2023-02-24

23 Items: view of buildinglead on window frame structure.combination between rise and tread.created where two roof slopes meet.length of projection beyond the forward perpendicular.is the fitting together of pieces to give a structure support and shape.a cluster of buildings in an enclosure, having a shared or associated purpose....

Craneville 4th Grade: 4-Cimini 2014-03-23

25 Items: MaxJoeMLillySarahJoeyDEmilyWyattPhilipMathewHannahOliviaLoganOLoganRBritneyCameronDominicTristenJanelleLindseyAryiannaMichelleMsMalletMrsCiminiMsCoakleyMrsSickell

4th Math Student Word Search 2022-06-03

42 Items: sumlcmgcfmodemeangramgraphrangemilesmedianpemdaslitersanglesmetersweightgallonfactorsdegreesaveragedecimalsdivisionmultipleadditionsymmetrydividendquotientparallelfractionsexponentsquadrantsmillitersdistributerightanglefactortreeconversionkilometerscentimeterstesselationmixednumbersperpendicularmultiplicationequivalentfractions

Mrs. Lopez's 4th Grade Class 2022-08-08

26 Items: amyelijoseivanjacearyanzuhranukkadavidashahoziaslopezoliversophialaylahkaviyamigueljavierjordannatalybrookedanielmclarenraymondariannachristopher

Mrs. Hawkins' 4th Grade Class 2023-06-26

28 Items: nicorahfbellacalebedgarjavonlinusnasirelkiesonianayamaianeailaniaubrieautumncarterkendrashirazwudasealbertdaniilbriellekinsleypranishtristinvaleriejonathanchantelle

Advanced Science II 2023-02-28

25 Items: that are kept in poucheswhat type of organism is yeastwhat shark "bones" are made ofWhat is shed when you desquamateEarth's largest invertebrate animalfrom a Greek word meaning indivisibleCystitis is the infection of what organWhat is the only venomous British snakeThe per capita birth rate of a populationPlant Kingdom group with species of Mosses...

Global II Review 2024-06-03

24 Items: "Gold, God, and Glory"Louis XIV's fancy house.Seafaring Scandinavian warriorsThe capital of the Byzantine Empire,The head of the Roman Catholic Church.Famous Empress of the Byzantine Empire.Probably the most famous German monk ever.The 1054 split within the Christian Church.A major Mesoamerican capital built on Lake Texcoco....