4th of july Word Searches

Globes, Projections, GPS 2024-03-22

19 Items: a person who makes mapsthe intended use of a projectionsize, shape, distance, distortionMap map of earth taken from spacemost accurate representation of the earthMap shows three-dimensional aspects of the planetMap shows the elevations, related to a relief mapMap shows land and water features shaped by nature...

PE2 2023-10-11

32 Items: DayPenMayYearbookWeekJuneJulyMonthTodayMarchAprilFolderPencilMondayFridaySundayTuesdayJanuaryNotebookTomorrowThursdaySaturdayFebruaryClassroomWednesdayMale StudentMale TeacherStudent DeskFemale studentSheet of paperFemale Teacher

Vocab 2 2023-10-12

33 Items: inpendaymaybookyearjunejulymonthtodaymarchaprilfolderpencilmondayfridaysundayaugustpleasestudentstudentteachertuesdayjanuarynotebooktomorrowthursdaysaturdayfebruarywednesdayits rainingstudent desksheet of paper

Part Of Building 2022-09-15

25 Items: is situated above the ground levelis vertical member of step on stairis horizontal member of step on stairis the vertical component of any structureis an isolated vertical load bearing memberare the main entry and exit point of any houseare the horizontal load bearing member of a buildingis a part of a wall just under an opening like a window....

Concepts of Chemistry, Physics, and Energy 2023-05-24

27 Items: a dissolved substanceenergy in the form of heatenergy associated with motionable to dissolve other substances.the basic unit of a chemical element.the degree of compactness of a substancethe speed of something in a given direction.the rate of change of velocity per unit of time.the ability to be dissolved, especially in water....

the date : days and months 2020-03-16

28 Items: MayJuneJulyMarchAprilfirstthirdfifthMondayFridaySundayAugustsecondfourthTuesdayJanuaryOctobertwelfthThursdaySaturdayFebruaryNovemberDecembereleventhWednesdaySeptembertwentieththirtieth

2020 PR 1 & 2 Wordsearch 1 2020-04-20

28 Items: MayJuneJulydoordeskMarchApriltablebooksSundayMondayFridayAugustwindowlightsTuesdayJanuaryOctoberThursdaySaturdayFebruaryNovemberDecemberbookcaseWednesdaySeptemberprojectorwhiteboard

Word Search - colours, weather, food, months 2021-01-19

28 Items: sunhotrainwindbluepinkjulyjunecakecorncloudgreenblackwhiteyellowpurpleaugustcheeseorangeweatherrainbowjanuarychickendecemberfebruaryseptemberwatermeloncauliflower

Unit 1 2023-05-29

23 Items: bagoldfromjulythreeseveneightclockclasstwelveapril;augustsixteenerasersjanuaryfebruarynovemberthirteen;seventeentwenty-fourtwenty-ninetwenty-threetwenty-eight

Summer vacation 2023-06-17

28 Items: sunfunbaypoolpondheatjulyriverbreakboatsgiftssummerbakingtubingfamilyvermontfriendsvacationnoschoolglampingsixflagspopsicleicecreammarylandbirthdaycamperamasummercamprollercoaster

arachne med 2023-08-05

28 Items: elleasyabaravallzizijulyrheyfayegiyasshaelsysasadiluclaunageniepiksinaevaindribillalyviaqeyrawintermatchanoelledanielmerrlynarielera

Bride Word Search 2024-02-29

28 Items: guscakewifelovejulykissveilvowsbridegroomringsdressfamilycouplegartertuxedoguestshusbandforeverflowersweddingfriendsmackennamarriageceremonyhoneymoonreceptioncelebration

chapter 2 basic chemistry vocab 2023-09-25

14 Items: the outermost shell of any atomAnything that takes up space and has massnumber of protons within the nucleus of an atomScientific study of the properties and behavior of matterA substance that can't be broken down by non-nuclear reactionsthe mass of an atom of a chemical element expressed in atomic mass units...

Mattot - Massei 2024-07-27

18 Items: מֹשֶהמַטוֹת“Neder”שְׁבֻעָהיִשְׂרָאֵלSon of Nun.Son of JephunnehHe died on Mt. Hor at age 123To grant pardon for an offense.Anyone who kills anyone may flee here.After leaving Ritmah, Israel camped here.You are not to pollute the land with this: ______“My house shall be called a house of ______ for all nations.”...

M1 Lesson 10 2016-01-18

30 Items: busgymJuneJulyroofmallhomeworknightSummerSundaybridgegardencinemamarketschoolmarketWeekendmorningnoodlescanteenbedroommidnightSongkranbirthdaysaturdayshoppinglunchtimeclassroomSecondFloor

Summer Holidays Word Search 2023-06-28

30 Items: hotparklatejulyjuneboatlakebeachcanoepicnictravelsunsetfamilysocceraugustcricketcottagecampingcottagefreedomswimmingvisitingbaseballheatwaveroadtripairplanevacationseptemberwaterslidesandcastles

Mont Y8 Statistics 2023-10-10

15 Items: The process of collecting data.Entities that collect different types of data.Selected without a particular order or pattern.A series of questions used in a survey or census.Information collected for the purpose of analysis.Data collected from a selection of a larger group.Data collected from the entire group being studied....

Vocab List 2 2024-02-22

31 Items: penMayBookJuneJulyMarchAprilfolderPencilMondayFridaySundayAugustTuesdayJanuaryOctobernotebookThursdaySaturdayFebruaryNovemberDecemberClassroomWednesdaySeptemberStudent DeskStudent(male)Teacher(male)piece of paperStudent(female)Teacher(female)

4th Period ELA 2020-12-18

12 Items: plotverbnounpronounfictionsynonymantonymsettingnarrativeadjectivecharactersforeshadow

Spelling practice English 2023-10-11

19 Items: The _______ of a owlThe _______of a snakeOpposite to many ________A baby horse ____________Rhymes with wish___________Opposite of few____________A shark is ______ (large) a man.The horse is kept in a ___________He can hear the buzz of the _________The kitten is kept in a _____________The puppy is kept in a _______________...

Constellation Word Search 2023-12-18

20 Items: giving off lighta milky band of lightbig bear constellationsmall bear constellationa floating rock in spacesomeone who explores spacerevolving around somethingthe coldest day of the yearthe hottest day of the yearthe study of celestial bodiesa group of stars that form a shapemirroring light that is put on themthe belief system of constellations...

Jennie's 2023 Wrapped in 23 Words 2023-12-23

23 Items: Klaus - My favorite holiday movie. Find it on Netflix!Raccoons - A family of five of them lives in our backyard.Barbenheimer - My favorite 2023 holiday. Cinema's back, baby.Apple Tree - We planted one this year, and it grew three apples.Trader Joe's - My favorite grocery store of 2023. Try the kimbap!...

Science Word Search 2023-05-16

20 Items: A row on the periodic table.A metal bonding with a nonmetal.Something that can be dissolved.A nonmetal bonding with a nonmetal.Something that can dissolve other things.The number of protons contained in an atom.A subatomic particle with a neutral charge.A subatomic particle with a positive charge.A subatomic particle with a negative charge....

Chemistry, Physics, Energy Concepts 2023-06-01

21 Items: the universal solventsubstance being dissolvedhow fast an object is movingexerting a force over a distancethe ability to do work or cause changesubstance that is doing the dissolvinganother term for negative accelerationmeasure of amount of matter in an objecta type of energy where energy is in motionhow much work was done over a period of time...

Office Word Search 2023-10-17

36 Items: desmondO_S _ _ _ _ _ _ORV example _ _ _80+ _ _ _ _ _ _ _H_A _ _ _ _ _ _ _R_PDO _ _ _ _ _ _New driver _ _ _ _ _ _Not sober _ _ _ _ _ _ _ _MM _ _ _ _ _ _ _ _ _ _ _ _ _Annual report by REO _ _ _ _ _VRU example _ _ _ _ _ _ _ _ _ _What we call a road _ _ _ _ _ _ _Form of stunt driving _ _ _ _ _ ________, move over _ _ _ _ _ _ _ _...

nvrt 2023-10-18

21 Items: polyppermianjurassicphasmidsflagella"false feet"reef-buildingtapeworm headhermaphroditic_________ ooze“little kidneys”having separate sexes_____________ explosionnematode glandular systemsegments in cestode’s bodyfree-living flatworms (Class)“bell form” cnidarian body planalgal symbionts of coelenteratesanterior chemosensory organ of nematodes...

vocabulary building 2023-02-20

25 Items: an entrydoor handlea set of stepsthe frame of doorwaybuilding upper storeya level of a buildingspread between two limitshorizontal upper of stairsthe top surface of a buildingtwo roof surfaces meet each otheran opening in a wall of a buildingthe lowest load bearing part of a buildingstructural element used to divide or enclose...

Human-Environment Settlement 2023-05-04

32 Items: to give support toremoval of all treesarea turns to a deserteffort to restore forestsraising of animals for foodelectricity powered by waterremoval of salt from seawaterwide variety of life on Earthhaze caused by chemical fumesresource that can't be replacedpermanently frozen layer of soilrich soil made up of sand and mud...

Final Exam Review 2023-06-02

34 Items: SI for timeSI for distanceSI unit of forceEnergy of motion.SI unit for energy.Speed plus directionThe change of velocityThe ability to do work.Characteristic or qualityEnergy that will run out.Change of position in timeMercury, Venus, Earth, MarsEnergy of position or stored.Example of a renewable energyJupiter, Saturn, Uranus, Neptune...

Cnidarians Word Search 2024-01-29

20 Items: Having a diet consisting of other animals.The ability of cnidarians to regrow lost body parts.Stinging organelles within cnidocytes, injecting toxins into prey.The union of egg and sperm outside the body, common in many cnidarians.Symmetry around a central point, a characteristic feature of cnidarians....

Unit 10 APES Review 2024-05-02

20 Items: Cancer causing agentsType of source pollution from a specific locationType of water with high biodiversity and productivityArea of permeable rock, gravel, or sand that holds waterCover 71% of earths surface and moderate earths temperatureType of water that is clear and has low biological productivity...

Fundamental Word Search 2023-11-18

20 Items: A type of suppressed demandTourism arrivals number refers to ____________ demand.___________demand is when geographical location of demand is changed.Tourism __________ are expenditures by international inbound visitors.Visitor arrivals into Singapore are also known as ___________ tourists....

Building Component ANF 2023-02-20

25 Items: rounded stairs edgeswall separating two independent plotlittle room that projects from a roofany level part of a building with a floorthe lowest load-bearing part of a buildingthe horizontal portion of a stair assemblysteel rods that building engineers set in concreteconnect the highest point of intersected roof sides...

Vocab PE2 2023-10-15

32 Items: inMaybookweekJuneJulymonthtodayMarchAprilfolderMondayFridaySundayAugustpleasestudentteacherTuesdayJanuaryOctoberits hotnotebookThursdayFebruaryNovemberDecemberclassroomSeptemberit's sunnystudent desksheet of paper

Med Terms Midterm Review 2023-04-03

20 Items: cell eatera bone cellsuture a tendondischarge of oildisease producingdifficult movementrecord of a vesselpertaining to bloodcutting into a veinfat tumor or swellingdestruction of a clotexcessively large heartlymph gland inflammationpertaining to against lifesurgical repair of a wrinkleinflammation inside the heartabnormal condition of no sweat...

GRID 1 2020-09-15

30 Items: REDMAYBLUEPINKGREYJUNEJULYGREENBROWNBLACKWHITEMARCHAPRILORANGEYELLOWPURPLEMONDAYFRIDAYSUNDAYAUGUSTTUESDAYJANUARYOCTOBERTHURSDAYSATURDAYFEBRUARYNOVEMBERDECEMBERWEDNESDAYSEPTEMBER

CALENDAR 2022-10-13

30 Items: maydayjunejulydateweekyearplanmarchapriltodaymonthaugustsundaymondayfridayjanuaryoctobertuesdayweekendfebruarynovemberdecemberthursdaysaturdaytomorrowscheduleseptemberwednesdayyesterday

a year 2023-10-18

30 Items: maydawnjunejulytodaymarchaprilsummerwinterautumnspringmondayfridaysundayaugustmorningeveningtuesdayjanuaryoctobertomorrowthursdaysaturdayfebruarynovemberdecemberyesterdayafternoonwednesdayseptember

WHEN? 2024-01-05

30 Items: mayjulyjunelastnextsoonaprillatermarchaugustfridaymondaysundayweeklyyearlyjanuarymonthlyoctobertuesdaydecemberfebruarynovembersaturdaysometimethursdaytomorrowafterwardseptemberwednesdayyesterday

Babcocks 2024-03-03

30 Items: lovefoodcakejulyevanvowsbridegroomaisleringspartyboozedressfamilygarterflowersdancingvanessafriendsweddingbouquetmarriageceremonyhoneymoongroomsmenreceptiondecorationsbridesmaidsphotographervideographer

Unit 9: Energy Sources and Consumption 2024-04-25

16 Items: energy from the sunburning wastes for energycoal, oil, and natural gasburns in the presence of oxygenmost common form of water powerusing fuel for both efficiency and heatlocation of the worst meltdown in historyreducing the overall amount of energy neededthe process of building the bonds of an atomthe process of breaking the bonds of an atom...

4th Grade Unit 4 2013-09-13

26 Items: DriedSkiedOpenedDancedDryingRobbedChasedSkiingArguedStoppedDancingOpeningStudiedSlippedChasingRobbingWorriedArguingStoppingHappenedStudyingSlippingWorryingOccurredHappeningOccurring

Celine Freeman 4th Period 2013-09-13

20 Items: MALCAVABIENVERTBLEUNOIRSALUTBLANCVIOLETORANGETREBIENTRESMALBONJOURAUREVOIRENCHANTEJEMAPPELLEILSAPPELLEELLESAPPELLECOMMECICOMMECACOMMENTAPPELLESTU

4th Grade Unit 29 2014-04-08

23 Items: reuserecallmisledreplacerebuilddisagreeinactivedistrustmistreatmisplacemisspellrecyclingincorrectmisbehavedishonestdisappearinvisiblemisfortuneincredibleincompleteindependentdisobedienceinconvenient

4th Grade Unit 29 2014-04-08

23 Items: reuserecallmisledreplacerebuilddisagreeinactivedistrustmistreatmisplacemisspellrecyclingincorrectmisbehavedishonestdisappearinvisiblemisfortuneincredibleincompleteindependentdisobedienceinconvenient

4th Grade Unit 26 2014-03-11

23 Items: myselfanywayhighwayweekendteammatedrivewayupstairsbaseballearringsdoorbellourselvesclassroomcourtroomnewspapernighttimesometimesclassmateskateboardchalkboardmotorcycledownstairsbasketballheartbroken

4th Grade Unit 23 2014-02-25

23 Items: totoowoodisleyourbeatbeetwaistaislethereguestpeacewastetheirpiecewouldbrakebreakthrownthroneyou'reguessedthey're

4th Grade Unit 35 2014-05-20

23 Items: ofoffouraresetsitthanquitlosethenweredairypedalpetaldiarywho'sloosequietwhosewe'requiterecentresent

4th Grade Unit 35 2014-05-20

23 Items: ofoffouraresetsitthanquitlosethenweredairypedalpetaldiarywho'sloosequietwhosewe'requiterecentresent

Evan Rhoten 4th grade  2014-10-21

25 Items: scaryspookyghoulszombietreatsskullstricksgoblinghostscreepywitchesfrightscostumepumpkincarvinghangmanhorrifyhauntedmidnightcemeteryskeletonchillingtombstonegraveyardmoonlight

WELCOME TO 4TH GRADE! 2022-09-05

27 Items: amiamilamyratateaidareidhenrycyrusbrettarronaidenjuditholiviaarcherwaylonhannahsonorawesleymonroeaylorasophiapamelawalteryannickclaytorjohnathanjazzalynn

4th grade Word Search 2023-01-08

38 Items: poprapclefbassfacesonghalfrestrockjazzstaffegbdfmusicwholepianoforteelvisusherswiftoperabluestrebleguitardjembedottedeighthhiphoprhythmukulelemalletsquarterbonjovirecorderkeyboardxylophonewednesdayclassicalspringsteen

Week 21 4th grade 2023-01-23

20 Items: redounusedunpaidrewinduntrueunloadrecallunevenuntidyrefreshdislikereplacerebuildrestartuncoverdisorderdistrustdiscolorunplanneddisplease

Week 21 4th grade 2023-01-23

20 Items: redounusedunpaidrewinduntrueunloadrecallunevenuntidyrefreshdislikereplacerebuildrestartuncoverdisorderdistrustdiscolorunplanneddisplease

North 4th Spelling Words 2023-01-24

21 Items: wornburnpurecuresoregearlearnharshboardhairyworthsparealarmearlydirtysquarereturnrecordthirstcoursecompare

4th Grade: Week 27 2023-03-09

20 Items: supplysinglemiddlesettlesampleturtlehundredexplainpilgriminsteadmonsteraddressfartherathleteorchardkingdomsurprisesandwichcompletealthough

Week 32: 4th Grade 2023-04-21

20 Items: halfcombcalmyolklimbhonorkneelfetchclimbfastenwreathanswerlistenhonestwrinkleknuckleplumbermortgagehandsomefolktale

4th Grade La comida 2023-05-22

46 Items: eat-teadrink-milk-soda-Food-eggs-soup-rice-salt-cake-fish-water-toast-beans-candy-bacon-steak-lunch-snack-pasta-pizza-coffee-cheese-pepperdessert-cookies-chicken-sausage-sandwich-potatoes-the billdrink/take-ice creamcarne-meat-hamburger-breakfast-I am hungry-I'm thirsty-orange juice-french friesdrinks-bebidas-dinner/supper-she/he is hungry...

My 4th Grade Class 2023-08-20

24 Items: elievemaxdukeislajanekateknoxpaulwrenblakechasejoveywyattcalliedeacongrahamharperoliviaameliabameliatcamillehendrixbeatrice

4th Grade 2023-2024 2023-08-30

24 Items: emmanoahlenixgranttanoasofiadannymacieeoliviaparkerjulianzaydenandrewelijahaubreyalaiyaemaleecharleymadisonjazlynnkillianlorenzopenelopevictoria

3rd / 4th Grade Class 2024-03-18

42 Items: wugiamiamayballellamarywongyingevansevansfloydmicahgomezlloydasherconorlaneykenziekoonerranjotdanikasydneymillercoltonsaeleeameliamicaiahmichaelledesmamarloweyamileeseegertfranklinmadrigallilyannareynoldsthreshertheodoremcdermottnarramoregangelhoff

4th Grade Sight Words 2024-05-07

56 Items: mapwarwindrockfastholdfivesteptruefarmdrawseencoldplansingfallkingtownunitwoodfireuponaminspacevoweltablenorthmoneyvoicecriedsouthfieldsofialistentowardpassedslowlypullednoticegroundfiguretraveldamiancoveredseveralhimselfmorninghundredagainstpatternnumeralcertainamalinaskarlettangelinamrscraig

4th Period Extra Credit 2024-05-17

27 Items: jjmarkcecewyattangelisaackasonmarcojamesemilyaliyahkaelenashtontaylorandreaoliviazandergisellekareenamarianonikolasshaelynnliliannams.oterichristianalejandragalejandran

4th Vocabulary all units 2024-06-13

50 Items: vetbatowlhotbankbearsoupnutscoldroofcoldwarmnurseactorhotelkoalapandapastapizzacoughatticsunnywindyrainysnowyskiingdoctorartistsingersquareyogurtcoffeegaragecloudyfishingsailingbowlingearachekayakingkangaroobackacheheadachebasementiceskatingrestaurantstomachachesnowboardingtrafficlightskateboardingmountainbiking

Ancient History 2023-07-17

20 Items: 490 BCE Battle of _________.9500 BCE Settled _______ began.2560 BCE Great _______ of Giza.6000 BCE _______ was discovered.200 BCE Paper is invented in China.776 BCE ______ Games first recorded.323 BCE Death of Alexander at _______.508 BCE Democracy introduced at ______.1700 BCE End of _____ Valley Civilization....

Famous Landmarks 2024-03-20

20 Items: petrabig-bentaj-mahalcolosseumacropolisstonehengeangkor-wateiffel-towermachu-picchugrand-canyonburj-khalifamount-everestmount-rushmoresagrada-familiapyramids-of-gizastatue-of-libertysydney-opera-housegreat-barrier-reefgreat-wall-of-chinachrist-the-redeemer

Executive Branch 2024-05-07

20 Items: Attacking the opponentWho is the current President?Who heads the executive branch?Using data/statistics to persuadeHaving someone famous support the candidateShowing lots of people supporting the candidateThe power of the President to postpone a sentencethe law What is the main job of the Executive Branch?...

Budgetdraft Word Search 2023-02-25

25 Items: cooking placeplace to showerbuilding supportunderground roomsafety on the stairthe face of buildingcost data used to designthe width of a rung is calleda loong pasage in the buildingthe height of a rung is calledis the topmost room of a buildingis where the entry of light and ventilationthe lowest part of the base of an architectural column...

Unit 11 APES review 2024-05-01

20 Items: Cancer causing agentsType of source pollution from a specific locationType of water with high biodiversity and productivityArea of permeable rock, gravel, or sand that holds waterCover 71% of earths surface and moderate earths temperatureType of water that is clear and has low biological productivity...

Vocabulary for Test 2023-05-16

25 Items: an egg or sperma form of a genea fertilized eggrequires one parentpart of a chromosomethe inherited allelessperm and egg combinethe study of geneticsa difference in a traita family tree for a traitan inherited characteristica change to genetic materiala type of asexual reproductionthe process that makes body cellsstructure made of DNA and protein...

Lesson 14- Life & Times of an Ant (4th grade) 2023-11-01

20 Items: dutymoviedailyalleyfiftyemptyturkeylonelycolonysteadyhungryvalleyhockeystarrymelodydrowsyplentyinjurychimneyprairie

Lesson 15- Life & Times of an Ant (4th Grade) 2023-11-30

20 Items: spiedcopiedpitiedeasierladiesbusiertiniesthobbieslazieststudiednoisierfamilieshappiestbreezierfunniestcountriesprettiesthealthierfriendlierbutterflies

Moose Lodge 509 Nov 2023 Word-Search 2023-10-11

20 Items: Our Lodge MascotMan's best friendCurrent US PresidentCurrent Chapter Senior RegentFirst name of the LOOM ChaplainNumber of barstools we have in useEditor of Anderson Moose HighlightsLast name of our Lodge AdministratorThese Members deserve our many THANKSThe largest planet in our solar systemLast name of our 2022/23 LOOM President...

Unit 2: Spelling Test 2 2022-09-27

25 Items: scenicembarrassedin a loud mannerin a curious mannerparticular; definitea two-wheeled vehicleto get rid of; removea large, ornate houseone who replaces anotherto consist of; be composed ofexcessive; unrestrained; imprudentto clarify the meaning of; to translatein a manner indicating great weightinessconsistently; with little or no variance...

Stress, Anxiety and Bullying 2023-05-15

25 Items: too muchbe afraid ofslightly angryfeeling of annoyancea feeling of physical tensionworry, unease, or nervousnessa feeling of emotional tensionelapsed time between two eventscausing or likely to cause harmextreme anxiety, sorrow, or painthe condition of being anonymous.responsible for flight, flee, freezemake or become less tense or anxious...

Chemistry, Physics, Energy Concepts 2023-05-30

21 Items: the universal solventsubstance being dissolvedhow fast an object is movingexerting a force over a distancethe ability to do work or cause changesubstance that is doing the dissolvinganother term for negative accelerationmeasure of amount of matter in an objecta type of energy where energy is in motionhow much work was done over a period of time...

Naturalworld Word Search 2023-06-02

34 Items: SI for timeSI for distanceSI unit of forceEnergy of motion.SI unit for energy.Speed plus directionThe change of velocityThe ability to do work.Characteristic or qualityEnergy that will run out.Change of position in timeMercury, Venus, Earth, MarsEnergy of position or stored.Example of a renewable energyJupiter, Saturn, Uranus, Neptune...

SPH4U Word Search 2024-01-21

21 Items: The change in velocity over timea balance between different factorsVelocity at a particular instant in timethe point where an object balances (3 words)The sum of vectors when they are added togetherThe stored energy of position possessed by an objectThe type of friction that occurs when an object is at rest...

SPH4U Word Search 2024-01-21

21 Items: The change in velocity over timeA balance between different factorsVelocity at a particular point in timeThe point where an object balances (3 words)The sum of vectors when they are added togetherThe stored energy of position possessed by an objectThe type of friction that occurs when an object is at rest...

Marquez Edmond 4th  2013-09-13

13 Items: cavaRoseNoirbluevertbienAviorblancroughvioletBonjourtresmaltrebien

Concepts of Chemistry, Physics, and Energy 2023-05-24

27 Items: a dissolved substanceenergy in the form of heatenergy associated with motionable to dissolve other substances.the basic unit of a chemical element.the degree of compactness of a substancethe speed of something in a given direction.the rate of change of velocity per unit of time.the ability to be dissolved, especially in water....

Concepts of Chemistry, Physics, and Energy 2023-05-24

27 Items: a dissolved substance.SOLUTEthe basic unit of a chemical element.ATOMenergy in the form of heat.THERMAL ENERGYable to dissolve other substances.SOLVENTenergy associated with motion.KINETIC ENERGYthe degree of compactness of a substance.DENSITYthe speed of something in a given direction.VELOCITY...

CH1 - Thermal Energy 2022-12-19

15 Items: The expansion of matter when it is heated.________________________The transfer of energy by electromagnetic waves.________________________A state of matter with no definite shape or volume.________________________The rule that energy cannot be created or destroyed.________________________...

Sea Word Search 2023-06-28

17 Items: rowgodboatwindrainsavepeterstormdoubtshorejesusof Godandrewpulledtwelvebelieveof Galilee

M1 Lesson 10 2016-01-18

30 Items: busgymjunejulyroofmallhomeworknightsummersundaybridgegardencinemamarketschoolmarketweekendmorningnoodlescanteenbedroommidnightSongkranbirthdaysaturdayshoppinglunchtimeclassroomSecondFloor

name of Town and road 2023-07-21

30 Items: julyjunewalesomaghderryfennypartypartypizzachipstonnebangorlondonfamilyfriendauntiebelfastweekendmorningtuesdaychickenmaghrerascotlandnutgrovebirthdaytobermoreballyclarecordarraghdraperstowndesertmartin

9/9/09 2023-10-16

29 Items: noemaysaulolgajulylovehoperamsciscofaithapartevelyndeniseperrisbudicefamilyanthonyoctobermissingfebruarydistancefranciscoyzarrarazseptemberriversidekingcobraapplevalleywillowparkhighnineninezeronine

July 2 Word Search 2024-06-28

14 Items: flatlanesyieldblinkerseatbeltpulloverspeedingaccidentcrosswalkacceleratedecelerateheadlightspedestrianintersection

Middle Ages Review Word Search 2024-03-01

19 Items: Mr. Murphy's catsFirst Holy Roman EmperorA mix of two distinct culturesCommon targets of Viking raidsA code of laws based on Roman lawThe capitol of the Byzantine EmpireThe social system of the Middle AgesLeader of the Eastern Orthodox ChurchThe economic system of the Middle AgesReligious wars that lasted for 200 years...

Astronomy Word Search 2023-12-18

20 Items: emitorbitmeteorplanetgalaxyequinoxreflectsolsticemilkywaymeteoriteursamajorursaminormeteoroidsstudy of spaceis a constellationis a constellation like bigdippera group of stars that forms a patterntrained person who is sent up to spacestorys and belief of the constellationsan icy object that leaves a tail of gas

Female Inventors Who Changed the World 2023-08-02

15 Items: First name Marie, discovered radioactivity.First name Margaret, creator of the paper bag.First name Mary, creator of the windshield wiper.First name Melitta, creator of the coffee filter.First name Ayla, creator of the Kindling Cracker.First name Maria, creator of the pop up life raft.First name Katharine, created non-reflective glass....

Task #13 - SPH4U Word Search (Lucas Soliman) 2023-06-14

25 Items: A quantity with only magnitude.The change of an object's positionThe x and y properties of a vector.The amount of matter within an objectThe amount of energy stored within an objectenergy in the form of motion within an objectA material that permits the flow of electronsThe rate of change within an object's position...

Your Occupation 2024-04-11

16 Items: uscisasylumServiceOfficerapplicantOF STATUSOF SUPPORTPROCESSINGderivativebeneficiaryACTION DATEadjudicationOF CITIZENSHIPinadmissibilityregistration NUMBERACTION FOR CHILDHOOD ARRIVALS

Adam and Eve 2022-07-18

15 Items: evegodmanadamgoodevillovefruitangelwomandeathserpentof Lifeof Edenfreewill

months days season 2022-01-19

29 Items: daymayweekyearjunejulymonthmarchaprilseasonaugustwinterspringsummerautumnmondayfridaysundayjanuaryoctobertuesdayweekendfebruarynovemberdecemberthursdaysaturdayseptemberwednesday

9/9/09 2023-10-16

29 Items: noemaysaulolgajulylovehoperamsciscofaithapartevelyndeniseperrisbudicefamilyanthonyoctobermissingfebruarydistancefranciscoyzarrarazseptemberriversidekingcobraapplevalleywillowparkhighnineninezeronine

4th Grade Unit 1 2013-08-22

24 Items: scrubthroatscreamstreetstrikesquarethreatthrownthrillsquealsquirmsquirtthroughscratchstrangesqueezestrengtharthritisastronautskyscraperstrawberryinstrumentsqueezabledescription

4th Grade Unit 8 2013-10-21

23 Items: oddofferhobbyworryborrowpaddlesupperbottlebubblesuffermatterriddenlettuceshudderwrittencurrenttomorrowslippersdifferentallowanceimpossiblegrasshopperMississippi

4th Grade Unit 10 2013-11-05

23 Items: bandcashchopwithintopondblocktoughyoungriverclosetcouplefingercousinwindowforgotblanketJanuarytroubleignoredbackpackPilgrimssouthern

4th Grade Unit 16 2013-12-17

31 Items: lazywantuglyuponJanaAdiahotelcrazyuntilAmenaMalakduringwashedmissedfatheralmostmagnetelevencomingalwayswasn'trepliedmustardhamsterdrownedTahseendeliveryfeelingsMissKellyAbedallahWinterBreak