Search Results

NHOB 001 2025-01-28

10 Items: THIS PROTECTS YOUR TOES.NOT FULLY SHOOTING A BOLT.TOOL USED TO TEMP A FASTENER.SEATS AND TIRES ARE INSTALLED ON THIS LINE.YELLOW COUPLERS ARE ASSOCIATED WITH THIS SYSTEM.THE ACCESS POINT TO THE REAR CARGO AREA ON THE ACCORDTHESE ARE THE THREE SENSES USED TO CONFIRM SET CONDITION OF A COUPLER....

Caleb Naizer 2025-04-23

10 Items: This person was a mysticThis person translated the bible to EnglishA belief that all protestants had in commonone of the three main denominations that emergedThe event that started the split of the churchedThis person challenged the authority of the churchThis person challenged catholic practices like indulgences...

Greek Roots 2025-09-09

10 Items: unusually or abnormally activeOveractivity of the thyroid glandNot judgmental; avoiding moral judgmentsA fundamental similarity based on common descentTo come together; assemble, especially in large numbersA word pronounced the same as another but differing in meaningHaving its source or origin outside the organism; having a foreign origin...

TTWF Values 2025-11-13

10 Items: Not being able to read or write.The short form of our organisationThe main purpose of TTWF is to _________________Doing the right thing, even when no one is watching.Working together with others to reach a common goal.Doing your work in the best, most effective way possible.Treating others fairly and valuing their feelings and opinions....

COMMON VERBS 2022-11-24

1 Item: CRY, THROW, TEACH, REACH, WORRY, HURRY, OFFER, PROCESS, PREFER, PROMISE, PROTECT, PROVIDE, PURCHASE, RECIEVE, REFUSE, MEAN,MANAGE, FIX, DAMAGE, OBTAIN

Photo Terms Search 2024-08-16

2 Items: BokehDepth-of-Field

Chronic Illness and Acquired Disability: Quality of Life 2025-11-26

11 Items: MSK chronic conditionMental health chronic conditionResponding adaptively to chronic disabilityLoss of this can involve a grieving process and adjustmentsWhat a patient might set themselves as part of their recoveryWho else is involved in improving their quality of life (inits.)(Something), psychological and social functioning needs to be addressed...

cardiac 2025-06-22

16 Items: High blood pressureMass of blood that can block vesselsMovement of blood throughout the bodySmall tube used to keep an artery openMedical specialty that focuses on the heartBulge in a blood vessel wall that can burstLower chamber of the heart that pumps bloodUpper chamber of the heart that receives blood...

CPR 2025-02-22

10 Items: The organ that pumps blood through your body.Saving someone from danger or a bad situation.When someone does not react or cannot be awakened.A method used to help someone when their heart stops.Pushing down on the chest to keep blood moving during CPR.What you do to reach emergency services when someone needs help....

Identifying Abuse 2025-04-01

10 Items: excessive or unjustified use of a drug.reducing the risk of future harm for DV patients.type of violence that patients above the age of 65.signs of bruising, cutes, burn marks, and swelling.failing to provide adequate care or support to a individual.identifying signs of abuse in patients upon initial encounter....

Amherst Word Search 2024-05-29

1 Item: inauguration depression President Coolidge America Goodhue Calvin July John terms thirty commander stars stripes

Math Word Search 2025-11-26

12 Items: MathTerms that have the same variableANY whole number (positive, negative, or zero)A number that cannot be expressed as a simple fractionthe distance of a number from zero, regardless of its signA symbol, usually a letter that represents an unknown value.A comparison of two values that are not equal, using symbols like <,>...

Dental Acronyms 2023-12-15

35 Items: - claim- Billing- Application- Beneficiary- claims payment- Claim inquiry form- Accounts Receivable- Claims Billed Amount- California Civil Code- Change Control Number- Claim inquiry response- Computer Based Training- Adjudication Reason Code- Corrective Action Request- Current Dental Technology- Beneficiary Correspondence...

Mid-term vocabulary wordsearch 2025-01-28

20 Items: Stay fit and healthyAffected with a diseaseTo stop doing somethingA plan to improve yourselfTo continue doing somethingWell-known for something badGive medical care to someoneGet well again after being illA lack of equality or similarityTo fix a problem or find a solutionExtend over a large, increasing areaTo start something for the first time...

All About Pete 2022-12-04

16 Items: The dog's "last name".Most common noise the dog makes.The dog's most frequent activity.The dog's current brand of dog food.Color of the dog's first & only toy.What Chad often instructs to dog to go do.Other water-based activity the dog despises.Popular crossbreed not recognized by the AKC.Arguably, the smallest part of the dog's body....

Semperfidelis Word Search 2024-04-15

24 Items: light and liberty-UNCto err is human-Senecafrom sea to sea-CanadaFor humanity-Wake ForestMake haste slowly-Augustusmind and hand-NC A&T + MITbuyer beware-famous proverbo the times! o the customs!always faithful-US Marine CorpsI think therefore I am-Decartesthus always to tyrannts-Virginiaart is long,life is short-Horace...

Donation Word Search 2024-10-16

161 Items: EXAMNDDRCDCSDAERFLOWWRAPKITSGEARDONORBLOODEVENTTRENDVIRALCODESLABELWASTECYCLESETUPSERUMAUDITLUNGSCHESTHEARTRANGERATIOUNITSALERTRISKSCENTERCHECKSDEVICEWEIGHTFROZENERRORSORPHANETHICSMANUALSALINESHARPSRETURNFLUIDSBOTTLECHARTSGRAPHSVITALSPORTALDOCTORLITERSSAFETYADDRESSREVIEWSNEXLYNKPROGRAMQUALITYTESTINGSAMPLESADVERSERESULTSPROTEINRESTICKRBCLOSSMACHINE...

Health Insurance 2024-04-17

6 Items: The healthcare items or services covered by a health plan.A legal agreement between two parties; the insurer and the insured.Legal entitlement to payment or reimbursement for your health care costs.The amount you pay for covered health care services before your insurance pays its share....

New Mexico Wellness Rio Rancho 2024-12-16

13 Items: airborne virusthe acronym for our facilitywho will arrive on December 25worn to protect against airborne virusesMedical Opiod Assisted Treatment acronymhow many days a week is our facility opentesting we perform to detect drugs and metabolitesHealth Insurance Portability and Accountability Act...

Personal Protective Equipment 2025-12-29

13 Items: Safety is everyone's responsibilityProtect your head from unwanted bumps.Shield your hands from cuts, burns, and hazardsHigh visibility saves lives; be seen to be safe.Guard your face; keep the air you breathe cleaner.Prevents the hair from falling onto your food, ewww.Wear them now, or later you’ll be asking “HUH? WHAT?!”...

Integumentary system 2024-09-09

20 Items: skin turns bluefancy word for oilanother word for hairthe A in the ABCD ruleregulates body temperaturearrector pili muscle functionfunction of lamellular granulesproduces the pigment of our skinthe inability to produce melanina part of the integumentary systemthis degree is a full thickness burnlocated at the base of hair follicle...

Random 2022-12-17

147 Items: betterbeyondbishopborderbottlebottomboughtbranchbreathbridgebrightbrokenbudgetburdenbureaubuttoncameracancercannotcarboncareercastlecasualcaughtcentercentrechancechangechargechoicechoosechosenchurchcircleclientclosedclosercoffeecolumncombatcomingcommoncomplycoppercornercostlycountycouplecoursecoverscreatecreditcrisiscustomdamagedangerdealerdebate...

Information Technology Services 2024-02-06

7 Items: T212 is the location of the _______The HelpDesk is open ________ to Friday 8am - 4pmOn what site can you find the HelpDesk Support Tab?Download this Microsoft phone App to chat, video, call other GCC StudentsThis MyGCC tab allows you to change your Password, MFA, and Create a HelpDesk Ticket...

Sensory Organs & PNS 2022-10-03

31 Items: ear waxsense of smellnearsightednessear inflammationinability to hearnoise in the earseyelid inflammationanother word for styhardening of the earpertaining to hearingcapable of being heardanother word for cryingsmall dark circle in eyeabnormal pressure in eyemucous membrane of eyelidsurgical repair of ptosisanother word for lazy eye...

Ch. 9 Vocab 2026-01-20

20 Items: To not includeThe Middle class"Without breeches"A fundamental truthAn annual direct taxHaving or showing abilitythe process of interveningOne who uses economic goodsRelating to within one's countryA sudden overthrow of the governmentPart of a whole divided into 100 partsThe basic principles and laws of a nation...

Basic Level Shaatibiyyah Reciters of Koofaa Wordsearch 2 2025-03-04

7 Items: The passing of these teachings isScholars agree there are how many main rules?refers to less common words that might be different from each other.which means making the letters clear and following the rules of tajweed.The author says each reciter has their own way in each chapter related to the rules, called...

Thin Word Search 2025-05-09

200 Items: newpieinnwaydiebayegothinbushsoakweardealmonkfacebiteplugselfcasequitmaskbellhelpsizeroofcropkillsavebombcarehangmovefearbarklovevainmazemildfroggaspfadesellmeatfearfoolsandwillglowstirtickfirsttradequeenplaceabuseshellswinggaffeslumpdancetermsgianttrainwoundbuildblamelearnsiegetwistdelayawarestriptiredsleepdeterqueueswipemanagepublicstrollnotion...

NUMBERS WITH SIGNIFICANCE 2025-10-10

16 Items: that doesn't changeor phrase used to describe a thingnumber that is not a fraction a whole number.numbers- a number without fractions an integeroperations- Numbers that cancel out or undo each otherconsistent or having a fixed pattern; liable to change.decimal- a number that is not a fraction a whole number....

May 2024 Safety Word Search 2024-05-01

10 Items: PPE stands for Personal Protective (9).Ensure that PPE fits each associate (8).Keep human food items in (10) areas only.Always (4) your hands after handling patients.Remember to keep cuts and scratches covered with a (7).Never attempt to treat open wounds without wearing (6).(8) is a common zoototic disease we see at the hospital....

Indian Literature 2025-09-29

10 Items: He is the author of Shakuntalawho is the author of epic RAMAYANA?collection of written hyms in praise of the godComprising prose prayers and litanies for ritualswhat is the name of Rama's wife who get kidnapped?refers to the collection of ancient religion texts from india...

Isaac 2025-08-25

193 Items: numbkeenmassarchvarycafégrimfleepeerdeaforalatomdoubtdailyglareaisleniecedoughcoughchiefanglecyclewhosetimidwrongtermsaheadchoseflingchaosalterouncelocalkneelcoastenjoyvaluemisusetonguebruisemurmurorphanheightmuscleschemerhythmpiercedecentcolumnchoosecerealcocoonaffectcasualannualcasualdeafenpluraleffectcourseoxygenexpandremedyassureagreedhorror...

Thin Word Search 2025-05-09

200 Items: newpieinnwaydiebayegothinbushsoakweardealmonkfacebiteplugselfcasequitmaskbellhelpsizeroofcropkillsavebombcarehangmovefearbarklovevainmazemildfroggaspfadesellmeatfearfoolsandwillglowstirtickfirsttradequeenplaceabuseshellswinggaffeslumpdancetermsgianttrainwoundbuildblamelearnsiegetwistdelayawarestriptiredsleepdeterqueueswipemanagepublicstrollnotion...

No Place Like Home 2025-04-29

22 Items: purple Texas wildflowerThe beach we frequentedMy ______ is back in TexasRicky's favorite University- Music festival abbreviationCity where all the yuppies live- Town where Ricky's dad residesFunny name for the collie at A&MExtravagant decor for prom girlsTexas team with pointy head-thingsThe best grocery store in the world...

The Great Depression 2025-01-10

22 Items: (CCC) gave unemployed people unskilled jobs.Successful in material terms; flourishing financially.The condition of having paid work; a job or profession.act gave drastic new powers to labor unions, causing another economic collapse.40,000 World War I veterans who marched to Washington DC for money promised to them....

Posties Dec 18 - Big Read 2023-11-24

6 Items: another word for "rubbish"knives, forks and spoons, used for eating and serving foodable to be decomposed by bacteria, so that it doesn't pollute the environmentto be unable to breathe because the passage to one's lungs is blocked by somethinga sea creature with a body like jelly and long thin parts called tentacles that can give a sharp sting...

Health Insurance 2024-04-16

7 Items: The conditions for which the insurance company will payThe Payment of benefits for covered sickness or injury.The Health care items or services covered by a health planA legal agreement between two parties; the insurer and the insured.What you pay annually for health services before your insurance company pays its share....

skin : Word Search 2024-10-28

30 Items: overproduction of pigmentdeficiency in perspirationgenetic term for fungal infectionthe least severe type of skin cancerthe overall color scheme of tan and creama cracks in the skin that penetrates the dermisfout-smelling preservation,usually in armpits or feetprimary lesion,flat spot or discoloration on the skin...

Cestodes & Trematodes 2025-02-21

15 Items: Tapeworm found in cats, using rodents as IH.Giant liver fluke affecting deer and cattle.Canine tapeworm transmitted through rabbits.Broad fish tapeworm found in freshwater fish.Equine tapeworm that affects the ileocecal junction.Lung fluke of dogs and cats, found in North America.Fluke known as the "lizard poisoning fluke" in cats....

Vocabulary 2025-11-20

15 Items: A nerve cellRemoval of wasteProcess of taking in substancesTissue that receives & sends signalsa unit used to measure the energy in foodswavelike muscle contractions that push foodplant material in food that is difficult to digestan organic molecule made from a chain of amino acidsTissue made up of skeletal, cardiac, and smooth muscles...

New Words from Lesson 12 Read 2026-01-22

1 Item: military, hospital, best, soldier, wounded, medicine, medical, supply, wounds, sew

MEDICAL TERMINOLOGY 2022-12-29

1 Item: ABRASION, ACUTE, ANAPHYLACTIC, ARREST, ASTHMA, CARDIAC, CASUALTY, CHRONIC, CONSCIOUSNESS, DEFIBRILLATOR, EMERGENCY, HEMORRHAGE, HIVES, HYPERTENSION, LACERATION, MIGRAINE, MYOCARDIAL, OVERDOSE, PREGNANCY, PRESSURE, PULSE, STROKE, TRAUMA, VENTRICULAR

Medical paractitioners 2023-05-26

1 Item: - angiologist - arborist - audiologist - biochemist - chemist - chiropodist - craft paper - dermatologist - domain expertise - educationist - Egyptologist - endocrinologist - entomologist - epidemiologist - Es - ethicist - expert - expertise - geneticist

Socialnetwork Word Search 2026-03-18

10 Items: The overall improvement of a community and its people.It refers to building confidence and competence through participation.The collaboration between students, professionals, and community members.Active involvement of people in community activities and decision-making.It refers to relationships and connections that strengthen community bonds....

Waybill Word Search 2023-01-18

19 Items: Storage/Flip questionsInvoice sent to customerCompany goods are sent toUser ID & password issuesAble to perform all functionsDerived from the customer’s BOLCompany that sends goods by railTerms which indicate when payment is duePays authorized invoices and print invoicesFor any invoices that are scheduled to pay to AOW....

Find 10 important terms from the text above in the puzzle below: 2025-10-23

10 Items: bagbookshopdeskclothcraftshelfposterdonationcommunity

MOWINGLEA 2026-02-28

14 Items: So stupid!The one they call...He wants to be Rob! I KNOW!Just can't live without Rob!Is this person here right now?Something you put on t-shirts.Another name commonly used for Rob.The apple didn't fall far from the tree.What Rob is to each of you and to the universe.A good word to scream out from time to time (Sp)....

Rocket League 2023-05-04

153 Items: ggmercgrogendokittr3mxgreylimepinkgoldrareokaygizmovenomesperzippydingomambafieronomadroninblackbasinoctanexdevilripperscarabtakumitritonvulcancentiofennecjackalmantisnimbustygriskomodomudcatoutlawcobaltorangepurplebronzesilvercasualrankedcosmiccommonimportexoticdominushotshotpaladinroadhogproteuscyclonediestroinsidiosamuraitwinzerskylinecharger...

Investments (Ch. 16) Word Search 2025-07-18

9 Items: The company's objective for entering into a hedge.At inception of a hedge, written proof of the hedging relationship.The option, in a convertible bond, to convert the bond to shares of common stock.Investment banker or other company that holds inventories of financial instruments. Counterparty....

February safety 2026 2026-02-09

12 Items: _____ 300 LogA __________ injury should be reported.Loss of ____________ should be reported.A Safety Hazard Report can be submitted ___________.Medical treatment ______ first aid should be reported.The log can help management determine where to focus their __________.If __________ isn't aware of a hazard, the less likely it'll get fixed....

Units 42-43 Sheet 4 2024-01-01

38 Items: (feminine) the itch, itching(masculine) the (male) nurse(neuter) the (anatomy) bloodto be of interest, interests(neuter) the (animal) octopus(masculine) the (animal) frog(neuter) the court, court roomto vote  (rel, to elect) εκλέγω(feminine) the freedom, liberty(masculine) the (anatomy) brain(masculine) the (anatomy) shoulder...

Middle Ages Review Word Search 2024-03-01

19 Items: Mr. Murphy's catsFirst Holy Roman EmperorA mix of two distinct culturesCommon targets of Viking raidsA code of laws based on Roman lawThe capitol of the Byzantine EmpireThe social system of the Middle AgesLeader of the Eastern Orthodox ChurchThe economic system of the Middle AgesReligious wars that lasted for 200 years...

vocabulary nimo 2025-12-27

27 Items: almost never;not oftenvery small in amount or degreewaste material that has no more valuethe outer layer or top of an object or bodyto prepare something so that it is ready to be usedbeing the only one of its kind ;very unusual or specialjoined together as a single unit or for a common purpose...

Ki Tavo 5.0 2024-09-15

18 Items: “KiTavo”Teshuvah“Mitzvot”Yeshua’s hometown.Your eternal homeland!Simon/Peter and AndrewThe author of Deuteronomy.KiTavo marks Torah portion # ?An evil that has been evoked upon one.The Hebrew word for ritual “uncleanness”.The Holy One’s favor or gift upon a personspell the Hebrew word “Bo”, meaning: ____________...

CORRECTIONS 2023-12-22

180 Items: jailmalevesttaserradiolunchfloydcourtbadgechiefdrugsscansjudgesirencrimewoundcodespoliceinmaterookiebookedlawtondinnerfisherbentonshowerreportpounitpatrolarrestbondedemailstypingfemaleintaketicketbuckleweaponmurderdangerorangesweatherbookinghousingboredommedicalofficerfifteenscanlonuniformdayroommonitorcamerascaptaintrusteekitchenrankingcustody...

Index Laws 1 to 5 2023-08-29

15 Items: The simplest way to write a number.Writing a number using a base and an exponent.Any number (except zero) to this power is always 1.Letters that stand in for numbers we don't know yet.A diagram used to find the prime factors of a number.Writing a number out as a product of all its factors.Making a math expression as easy to read as possible....

PF Ch1 Gross Income 1.5-1.7 Key Terms 2025-02-11

5 Items: salarycommissioncommissionratestraightcommissiongraduatedcommission

Oppositional Defiant Disorder/Conduct Disorder 2025-03-13

10 Items: ODD is typically diagnosed in this stage of life.This mental health condition often coexists with ODD.A child with ODD may deliberately try to _____ others.What biological factor may contribute to ODD development?ODD can sometimes develop from harsh or inconsistent _____.More severe cases of ODD show up in how many or more locations?...

Organs word search 2026-03-26

10 Items: The largest organ in the bodyThe most commonly donated organMarkiplier's new film, Iron ____Containing acid with a pH as low as 1The organ famously injured by Phineas GageA recognizable symptom of its failure is jaundiceAn organ with a tadpole shape comprised of a head, neck, body, and tail...

CORRECTIONS 2023-12-04

169 Items: jailvesttaserradiolunchfloydcourtbadgechiefdrugsscansjudgesirencrimewoundcodespoliceinmaterookiebookedlawtondinnerfisherbentonshowerreportpatrolarrestbondedtypingintaketicketbuckleweaponmurderdangerorangesweatherbookinghousingboredommedicalofficerfifteenscanlonuniformdayroommonitorcamerascaptaintrusteekitchenrankingcustodyfederalwriteupodyssey...

VR - Chapters 6-8, 12, and 20 2025-09-21

22 Items: symptom of stresssymptom of stressagainst medical adviceexample of folk healingliteral meaning of wordslearn by touching and doingperiods of worsening symptomsshows concern and willingness to helplearn by seeing, reading, and watchingcommunication by the conscious use of wordsreflects the same words back to the patient...

Cam Word Search 2026-04-08

20 Items: Prevention of harm during healthcare deliveryRecording supplement use in the medical recordNonprescription products like vitamins and herbsHerbal sleep aid that can increase sedation riskKey strategy to improve provider knowledge of CAMEfforts to make healthcare safer and more effectivePrinciples guiding safe and responsible patient care...

June Wordsearch 2025-05-03

19 Items: Public celebrationBioluminescent insectsA period of travel or restThe warmest season of the yearA period of unusually hot weatherThe zodiac sign starting around June 21.A popular outdoor cooking event in summerThe zodiac sign from late May to mid-June.A seasonal fruit harvested in early summer.A ceremony for completing an academic degree...

Illicit Drugs - Daily Review 2023-08-22

22 Items: The most common reason why people start to take illicit drugs. (9)Drugs that alter or distort the brain's perception of reality. (13)Drugs that speed up the Central Nervous System (CNS) responses. (10)Drugs that slow down the Central Nervous System (CNS) responses. (11)Drugs with multiple effects on the Central Nervous System (CNS). (5-6-5)...

Procedure Text 2025-07-27

20 Items: ordinary/commonverb, act, duty,part of ingredientsa stage in a processa set of instructionThe name of a projectexisting or happening nowverb, to produce somethingis a kind of question wordThe instruction or directionunspecified or unknown thingdirect command or instructionconstruction or organization of something...

Transfer Word Search 2025-10-18

21 Items: Partner to study withExtra help with courseworkOn-campus housing for studentsHelp paying for college expensesRutgers–Newark athletic teams nameAcademic term lasting about half a yearHub for student activities and hangoutsFast-paced event for meeting new peopleAdjusting to a new college or universityFeeling included and part of a community...

Cats 2026-01-17

25 Items: Cat with extra toesDesign in a cat’s coatTri colored coat patternCleaning fur with tongueMark left by a cat’s pawEarly life stage of a catShots to keep cats healthyCommon striped coat patternClaws that can be pulled inBond between cats or peopleBox used to transport a catSpeckled multicolor cat coatClump of fur a cat coughs up...

TWO Gaming Puzzle #1 Join us at discord.gg/twogg 2023-09-30

20 Items: Gaming term for a killClassic roguelike dungeon crawlerOld D&D term: To Hit Armor Class __Recklessly charging in, from a WoW memeUnclear areas of a game map until exploredSmall in-game purchases, often controversialUnit of distance, also a game streaming toolWhen characters explode into pieces in a gameWhen your character dies and can't be revived...

Unit II Review - Early River Valley Civilizations 2024-10-07

23 Items: Seasonal windsRanked by statusA Mesopotamian templeImportant Egyptian riverAnother word for farmingTaming plants and animalsNatural barrier in northern ChinaAnother name for the Huang He RiverOne of the first written legal codesAnother word for a "complex society"One of two important Mesopotamian riversOne of two important Mesopotamian rivers...

dandysworld 2025-05-21

163 Items: veepopFinngigigoobcoalbonemaingustslowrareCosmolooeypoppytishayattaastrococoaflyterudiedandyalarmbrickdiarytapesstarsstatsvalvedinerichorspeakbullytiredtoonsBoxtenConnierazzledazzleRodgerScrapsteaganbassiepebbleshellysprouteggsongingerwrenchtoykitbonbonmedkitreelincomedytidyupwindupcommonlethalheartsdamagehealerkitingFlutterglistenshrimpotoodles...

Griot Word Search 2025-11-17

25 Items: RulerStorytellersInbetweenersCapital cityMeans "people"Group of travelersSole control of tradeImportant trading cityRuled from 1307 to 1332Reported Muslim historyBoat with triangular sailCenter of trade and learningFounder of a line of emperorsFertile grassland, South of SahelDescendants from a common ancestorCulture of Bantu speaking migrants...

2026 Dallas County Word Search 2026-04-07

160 Items: cademsbobjoedogncoiiivinhitcchdnremafireadelroambeatkarljillryonkaiajackadamabbybirdechohelpncicjailsendgoldherocalmlifeiaedpingedmspaceravecatsmouseradioperrygrassbrushsouthnorthtonyacarlahollybrianbrentgraceshoessirenbadgechiefphonedustyentryglennbreaknurserandyalarmsleephumormediclermstylerdrugsterryclerkroadstireddeputycommonpolicedawsonbouton...

The Twelve Traditions - Traditions 1 through 3 2024-07-11

25 Items: We teach by _____. (pg 149)Desire is not a measurable _____. (pg 144)The mechanism we use is group _____. (pg 135)We cannot measure or arbitrate _____. (pg 146)We don't have to _____ for anyone else. (pg 150)Group conscience is not fixed and _____. (pg 136)We are free to offer welcome instead of _____. (pg 145)...

Workplace Incivility 2025-08-01

7 Items: What is essential for effective teamwork and open communication? TrustWhat is required for a group to work effectively toward a common goal? TeamworkWhat quality allows someone to understand and share the feelings of another? EmpathyWhat is the term for rude or unsociable speech or behavior in the workplace? Incivility...

Latin Roots 14 2024-04-24

26 Items: comemixt mixmob, movelie; restject throwtend towardlie; reclinelean; inclinesess sit; settlemiss send; let goa sloping surfaceclose to or next toto take the place ofto strive or work againstto assemble or come togetherstit, sist put in place; standthe ability to move or get arounddrawing apart from a common pointa law enacted by a legislative body...

Pookie Open When You Are Bored Word Search 2025-02-23

24 Items: MeYouForkBoth of usWhere we metMy Favorite PokémonWe are gonna get ___THE WORST TRANSFORMERWhere we get shareablesThe day we started datingThe Pokémon you said I amThe month we started datingThe first time we actually metThe pet name we call each otherThe teacher whos class we met inThe Pokémon that is literally you...

Escape from Mr. Lemoncello's Library Vocabulary 2025-03-17

55 Items: oldequalto rushforbiddenpunishmentmysteriousto figure outto take turnsto throw awayto crash intorefuse to obeyA central roomjudge's hammerto think aboutto leave behindno longer in useto steer or directa noisy disturbanceto pronounce clearlyvery great in degreethe study of animalsA secure room; a safeto settle differenceselegant and fashionable...

8th-Ethics Committees 2024-11-13

9 Items: one of the activities ethics committees doplace where an ethics committee may work; related to healthscientific career that usually forms part of an ethics committeeplace where an ethics committee may work; related to investigationnon scientific career that usually forms part of an ethics committee...

Gabrianna & Krystoffer 🥰🔒😘 2023-06-18

15 Items: first date togethermost common food we eat 🐷Something that describes usLocation of are first kiss😘My fav song I stole from my baby🤤Are favorite color and fav hobby🌲😂Something we do alot since cherries …🪱Place we get pizza deleivered to alotttFavorite show we watched together so farstate you want to take me to on vacation...

How to Survive a Tornado 2024-10-08

13 Items: The shape of a tornadoAnother word for a tornadoWhat can a tornado sound likeWhere should you go to survive a tornado?what type of air can be a sign of a tornadoWhat is the name of the tornado we talked aboutif stuck outside, where is the safest place to hideThe most important thing to focus on during a tornado...

Kiley's word search 2024-05-21

15 Items: soft tissueconnects bone to boneconnects bone to muscleLargest artery in the bodyforms the skeleton of headknown as the 'common shoulder muscle'Inner organ for the circulation of bloodblood vessels located throughout your bodydistribute oxygen-rich blood to your body.transport materials throughout the human body...

Safety and Injury Prevention 2025-04-01

15 Items: What number should you call in an emergency?What should you do if someone is having a stroke?Which organization provides first aid certification?What type of website domain is usually more credible?What procedure is used to help someone who is choking?What is the process of evaluating risks before acting?...

Tech Type ff 1 >> DIRECTIONS: find vocab terms/words going forward, backward, up/down & down/up 2021-02-16

18 Items: WPMkeysAWPMhitsspeedtypingQWERTYmisseserrorsnumbersletterssymbolsstrokescorrectstandardaccuracykeyboardingpunctuation

PSY 252 Exam 1 Word Search 2024-09-17

10 Items: portrayal of how gene expression is altered by external factorsa prediction or hypothesis in describing gene alteration and it's causesthe division of the cortex based on functionality in terms of characteristicswhen discussing drug use, the interference in natural motivational effectiveness...

Risk Reduction, Wellness, Health Literacy 2025-04-30

25 Items: Reduces risk of injury in sport.Crucial for an athlete's well-being.Practices for better rest and recovery.Can impair healing and immune function.Needed after intense training or games.Personal check for unusual body changes.Can influence risk behaviors in athletes.Tracking patterns to prevent future harm.Strategy to balance training and recovery....

At Your Service Signature Moves Word Search 2022-06-01

6 Items: Listen carefully to their needs and say "I can help you with that."Walk them to the door and say, “Thank you for visiting and for being an AT&T customer!”Review the Order Recap and Customer Service Summary; offer to email it to the customer.Be sure you’ve resolved the reason for their visit and ask, “Have I taken care of all your needs?"...

Urinary 3 2025-11-20

12 Items: Another name for renal transplantThe __ adrenal gland is easier to seeNeonatal renal sinus is ___ (echogenicity)Posterior urethral valves are only found inMost common fluid collection post-transplantThe patient's own kidney is reimplanted into the iliac fossaCommonly, the renal transplant will be placed into this iliac fossa...

Ethics Committees 2025-02-06

9 Items: one of the activities ethics committees doplace where an ethics committee may work; related to healthscientific career that usually forms part of an ethics committeeplace where an ethics committee may work; related to investigationnon scientific career that usually forms part of an ethics committee...

Halloween Fun 2025-10-09

19 Items: Undead bloodsuckerSpirits from the beyondThis is the witching hourCreatures in The Walking DeadBoard game that tells fortunesThis song is a graveyard smashA large pot for brewing potionsThe author of The Tale Tell HeartA raven's quote or school for WednesdayThese creatures transform at the full moonThe most prolific horror author of our time...

Cycle 1 S2 Week 1 2025-01-15

5 Items: A list of numbers or objects in a special order.The use of statistics to determine the probability that a given hypothesis is trueA restatement of a text or passage giving the meaning in another form, as for clearness; rewordingUS History: The withdrawal from the Union of 11 Southern states in the period 1860-61, which brought on the Civil War....

Wonder Vocab 2025-11-08

14 Items: To speak very softly and quietly.A talk between two or more people.To want something to happen or be true.Normal or usual; not special or different.To keep someone or something safe from harmTo learn at home, usually taught by parentsTo act like something is true when it is not.To look at someone or something for a long time....

Cooperative 2023-01-05

1 Item: collective joint collaborative combined mutual common communal united concerted

Substance Abuse* 2024-12-18

11 Items: The percentage of alcohol in your blood.Psychological desire for the effects of a drug.The chemical in cannabis that makes you feel high.Something a person feels when they stop taking a drug.The organ in the body responsible for detoxifying alcohol.A group of drugs that includes Fentanyl, Codeine and Oxycodone...

Unit 9: Energy Sources and Consumption 2024-04-25

16 Items: energy from the sunburning wastes for energycoal, oil, and natural gasburns in the presence of oxygenmost common form of water powerusing fuel for both efficiency and heatlocation of the worst meltdown in historyreducing the overall amount of energy neededthe process of building the bonds of an atomthe process of breaking the bonds of an atom...

VA Acronyms 2024-05-20

86 Items: GroupConsultNo ShowPatientScheduleDiagnosisFollow UpAs NeededDrive TimeIn PatientOutpatientAppointmentFasting LabsPrescriptionTour of DutyMental HealthMy HealtheVetCommunity CareWomen's HealthConsult ToolboxFile Entry DateSame Day ClinicStandard of WorkVA Video ConnectBehavioral HealthService ConnectedWait Time StandardAfter Visit Summary...

November Safety 2024 2024-11-11

12 Items: Acronym for Waste Anesthetic GasesDo not over inflate ______________ tubes!Adequate ___________ is key to reducing WAGs.Loose-fitting tubes/masks are common source of ________ gas.Making repairs, correcting problems, or performing routine checks.When note in use, the __________ and oxygen should always remain off....

Vocab Word Search 2024-04-26

12 Items: A state of being confused or lost.to take an action on behalf of anotherHaving a manner that is confident or livelyA long amount of exposure to the atmosphereTo disappear or can be the cause to disappearRelates to having or being focused on somethingA way to make a score on a orchestra performance...

Glass Bottle Archaeology Word Search 2025-10-14

18 Items: the top of a bottlethe bottom of a bottlethe main part of a bottlemolten glass used to make bottlesbubbles or air pockets in a bottlethe part below the lip that flares outa raised ridge encircling a bottle neckraised lettering or designs on a bottlethe transition from the neck to the bodythe transition from the body to the base...

Animal Life Stages 2026-03-03

12 Items: The study of animal behavior.Most common diseases in geriatric patients.Specific nutrient that helps kittens gain energy.Involves housing, diet, and environment of animals.Contain the most energy per unit weight of all nutrients.Branch of medicine dealing with problems and diseases of old age....

Word Search 2025-10-15

13 Items: amount of matter in an objectthe change of position of a objecthow fast and in what direction a point is movingspeed of an object at a particular moment in timequantity of motion that applies to moving objectslength between objects or points without regard for directionforce that is exerted by one object on one or more other objects...