Search Results

Gato Word Search 2023-03-02

19 Items: a very common house petword to describe someone strongA place where people go to learna big gray animal with huge earswhat people are born with to seeOne of the most common house petswhat we use to type on a computerword used to describe someone weaksomething students use to write ina common instrument with 6 strings...

Las Posadas 2023-11-28

13 Items: They ______ holiday songs.The word posadas means ________.The word ______ means inn or lodging.These ________ can be held in churches.The _________ is usually shaped as a star.They sing holiday songs and carry a ________ scene.This tradition begins on the 16th of _____________.A child is sometimes chosen to be dressed as an ________....

Senior year 2025-11-02

11 Items: Word-Oscar night. -Leaving ACA-Kashta. - lunch-senior Dinner -sign outDay. - senior Night -trip-crazy day. -senior walkTrip. -senior field Day -sports day-pink day -Grade rehearsalfirst day -Uni shopping -Graduation...

Senior year 2025-11-02

11 Items: Word-Oscar night. -Leaving ACA-Kashta. - lunch-senior Dinner -sign outDay. - senior Night -trip-crazy day. -senior walkTrip. -senior field Day -sports day-pink day -Grade rehearsalfirst day -Uni shopping -Graduation...

graph=write 2025-10-30

10 Items: the writing of one's own namea book written about a person's lifemapmaking/ the writing of a map or chartrecord player, turns writing on records into soundthe use of light to record an image using a camerawriting about a person's life written by that persona device that writes down the movements of the earth...

Senior year 2025-11-02

11 Items: Word-Oscar night. -Leaving ACA-Kashta. - lunch-senior Dinner -sign outDay. - senior Night -trip-crazy day. -senior walkTrip. -senior field Day -sports day-pink day -Grade rehearsalfirst day -Uni shopping -Graduation...

Group Literacy Word Search 2025-08-14

31 Items: CiteInferThemeGenrePrefixSuffixAnalyzeComparePredictExplainClarifySupportContextLiteralSynonymAntonymContrastEvaluateDescribeIdentifyEvidenceSummarizeInterpretDetermineMain ideaRoot wordNarrativeConclusionFigurativePerspectivea list of 30 common **6th grade literacy vocabulary words**:

Heat Transfer Vocabulary Wordsearch 2025-01-29

7 Items: Another word for HeatThe Definition of EnergyHow Temperature is measuredHow Radiations transfer heatHow Convections transfer heatHow Conductions transfer heatThe Type of energy that Thermal Energy is

Year 3 Term 2 Wk 2 Homework 2024-05-05

24 Items: DramaAn accidenta situation4 letter wordjoyful emotionsomething organisedPrecious to someone1st Month of the yearto won of give somethingorganising something nowOut in the bush on holidaysa crunchy red or green fruitEarth, Mars, Jupiter are theseTo get from one place to anotherA place where you go to get moneyNot perfect or excellent just.......

Unit 4: Spelling Quiz 1 2022-11-29

30 Items: comicaltruthfulnessshowing mercymarking a distinctiona physical disabilitydefiance of authoritythe operation of aircraftto set or keep apart; dividenasty or disgusting in naturean overseer or head of a groupto grasp suddenly and forciblyof a particular person; privatethe pouch which encases a letterthe biological science of animals...

Ha’azinu 2024-09-29

18 Items: “Lawlessness”aka, Rosh HaShanahSimon Son of Jonah“Shuvah” means to _______The 8th letter of the alef-beit.This Hebrew word means “to speak”Repentance results in __________.Son of Barachel the Buzite (Job 32)“Heaven an earth” in the Song of Moses.HaShem’s revealed teaching for mankind.The letter peh has a pictograph of a ______....

Floccinaucinihilipilification Word Search 2023-10-20

75 Items: okejoybitthesitpopmopboxfoxcatsczarzetapinkweekdayshardtreewordplantwinartslavagamethemwhatwilljumpwereablemoredoorrainquestwindywatercartsmusicglasstrainemoteciderfirststartslyncheshandiertheatersmonumentcesspoolscatalogedturnaroundwristwatchmanservantmemorandumsunutterableunnaturallymenstruatednanosecondsplayfulnesstimelessnessunattainable...

No Title 2025-05-06

75 Items: SumOddOneTenTenAddBarPartSkipEvenZeroUnitLessBaseHalfDataWordFormSensePlaceValueDigitWholeRoundOrderCountEqualAfterGroupTallyChartRatioGraphTotalNumberSymbolBeforeAddendDoubleComparePatternHundredNumeralGreaterBetweenNearestComposeFactorsProductDecimalPercentBalanceIntegerEstimateSequenceThousandEquationSubtractAdditionQuotientFractionRounding...

the hatchet and people i know 2016-12-09

72 Items: MrMrfunbowbowDogoldBalDanJoeRobMrsbookmovefishtipswildwolfCarlSongWoodsongwordkithMattGregAlexLisakiwiGaryBillAdamMotaSovahatchbearsBrianstoryhonerAntonLauraAllanNancyshayaarrowsskunksauthorsearchRobertHarveyAngelaJustinshelteranimalsturtlesnewberydancingtrackerRobesonFrancesGrandmasurvivalsentriesserenitysurvivingGreg-dubewildernessthree-time...

Monday Word Search 2023-09-11

72 Items: tvdogcatoneredfunyoushearecankingpassexamknowopenbookreadnounverbwordhavemustmarkthirdqueenlearnenjoythinkspeakpupilmathsmondaysundayaugustfriendfamilytwentylondonlessontravellistenadverbsuccesshundredbritainenglandirelandexploreanalyzepresentenglishpronounstudentteacherscotlandresearchcopybookworkbooktextbookmemorizealphabetwednesdayseptember...

slay 2025-10-24

59 Items: tearaeyupcartridewordmoonfishdirttreesimslionstorefartypartyfrogstoadsdancejoe'slibragoulsturtleribboncactusflowerspiderlettershartygallopdreamswarmthnovelsmozartsearchdangerspookyclownsghostsblockstalkingsnoringanimalsreadingnuggetschargeraxolotlgoblinsshoppingscorpionmcflurrymountainaquariusshortcakewinehousepepperoniplatformsliterature...

I N F O R M A T I K A 2025-08-29

75 Items: LanManWanRj45HdmiCCTVAsusAcerOppoVivoMeshStarRingBiruWifiWordTreeModemMouseKabelTeslaAppleStackQueueHijauHelioLinuxCyberExcelCiscoSwitchServerTesterLenovoIphoneXiaomiCameraHybridCoklatOrangeLaptopMemoryUbuntuRouterCodingNetworkMonitorSamsungPrinterAdaptorSortingWindowsInfinixChipsetHotspotJaringanKomputerKeyboardInternetCrimpingMacintosTopologi...

Sentences, Subject, Predicate 2023-08-25

16 Items: a commanda questiona statementexpresses a strong feelingwhat the sentence is abouthas one subject and one predicateall the words in a subject of a sentencetells what the subject does, has, or is likeall the words in the predicate of a sentencea group of words that expresses a complete thoughtwhen two or more subjects share the same predicate...

Grade 1 Word Search 2024-10-06

20 Items: – To consume food.– Feeling or showing joy.– To move quickly on foot.– To perceive with the eyes.– A word used to express agreement.– A small animal often kept as a pet.– A loyal animal that is often a pet.– A place where children go to learn.– To move through the air using wings.– A round object used for playing games....

Unit II Review - Early River Valley Civilizations 2024-10-07

23 Items: Seasonal windsRanked by statusA Mesopotamian templeImportant Egyptian riverAnother word for farmingTaming plants and animalsNatural barrier in northern ChinaAnother name for the Huang He RiverOne of the first written legal codesAnother word for a "complex society"One of two important Mesopotamian riversOne of two important Mesopotamian rivers...

Occupational Word Search 2025-03-23

20 Items: What is Ellee afraid of?What is Ellee's school mascot?What is Noah's sibling's name?What is Noah's favorite candy?What is Ellee's sibling's name?What is Noah's favorite soccer team?What is Ellee's favorite music group?What was the name of Ellee's hedgehog?What is Noah's favorite ride at Disney?What is Ellee's favorite ride at Disney?...

Farm 2023-05-08

32 Items: cowpigdoghayfarmBankduckmuleeggssoilgoatseedshorsecropssheepgoosefarmerplantsdonkeytractorchickensC S I T R E M R A F W M Q LH T C O W U C D Q B U I T VI S D E E S C R F I K Q T GC P F L J H E D O N K E Y OK O P E E H S L S P G M D OE S R O H F P X U G S O G SN P R P L A N T S M G P A ES V T P D Q V O D P I E Z TA R O T C A R T O P I G O S...

Brave Word Search 2024-10-06

20 Items: – To consume food.– Feeling or showing joy.– To move quickly on foot.– To perceive with the eyes.– A word used to express agreement.– A small animal often kept as a pet.– A loyal animal that is often a pet.– A place where children go to learn.– To move through the air using wings.– A round object used for playing games....

End of Year Word Search (SSL1) 2024-05-28

31 Items: dog______ear______sun______book______bird______head______food______star______leaf______dirt______lake______woman______write______quiet______angel______fruit______cloud______river______stone______father______window______cookie______summer______I praise______mountain______eye____________elephant____________I'm Great____________Excuse me____________...

And Word Search 2025-05-19

74 Items: ifonofandoffmadsadfathatyouearonetwosiztenlikeyourhatelovesingquizwordfoodnoseearsopenshutnicemeannounverbfourfiveninekitesandtrackangryhatedlovedlikedwordstrickmouthcloseknifenightnounsverbsthreeseveneightfightmightsandygramsfriendpluralpuzzlesearchtrickyclosedmurderknightgrainsouncesfriendssinginggumballhundredmultiplesingularthousandadjective

Gravity Falls 2024-03-06

8 Items: Who worships Stan?Who is Mabel’s pet?Who is a mind demon?Whose real name is Mason?What does Wendy represent?Who loves to wear sweaters?What is a popular soda brand?What word does Soos mispronounce?

Greek roots week 3 2025-09-09

10 Items: not academicextremely activetaking no actionsextremely sensitivesame types of graphssame word different meaningcoming together and talkingover active and doing to muchopinions or doctrines with the official positiongrouping made up of many differing or unlike parts

Where Am I? 2025-11-24

7 Items: Sounds like a bubble pop — twice.Shares its name with what you do to cards.Begins with a strong K and a punchy “-ump".Contains a word you use to keep a door shut.Starts with a big, wide W, has double A’s, and hints at arms swinging again and again.The word starts with “Break,” but no objects are damaged it’s about crashing into moves....

Chukat ~ “Statute” 2024-07-07

17 Items: Moses’ sisterAbraham’s nephewHe dies at Mount HorHebrew word for “statute”Hebrew word for a good work.Hebrew for “instruction” or “teaching”“outside the camp” during Temple times.Messiah Yeshua is the _____ of the Torah.The last enemy to be destroyed. 1Cor15:26The person who took Yeshua’s body away for burial....

Root Word #11 Practice 2025-03-25

10 Items: breakgood, wellmake, donebear, bring, carryflee, runaway, escapeto move to another placea part of a larger wholea protected place to flee toa place where things are madereplacing an offensive word with an offensive one

Word Search Fun 2025-08-14

10 Items: The number 14The number 19Belonging to usPast tense of “say”The opposite of badPast tense of “come”Shows necessity; have toAt this moment; immediatelyAsks about a place or locationA polite word used when asking for something

Medicine 2024-07-03

6 Items: You put it on your woundsA tube used by a doctor or nurseYou take them to grow well and be healthyYou spread it on your skin, esp arms and legsPeople who can't walk sit on it and move through it...

Blessedtrinity Word Search 2024-12-17

17 Items: The freedom and ability to choosean agreement with God and his people(hint: What does the word Gospel mean?)- Good News(hint: What does the word Genesis mean?)- beginningA thought, word, deed, or omission against God's lawan area in the Middle East that Include's present-day IsraelRevelation - God making himself known to us through creation...

Random 2022-11-21

76 Items: popsayfarsadcitywordhomelovehugspostopenwiferockfoodlefthalfhopearmyburnlifereadminehelpcoldprintsmilewitchnoonecloseproudfisrtpizzarightmummycrashdiarysharespicysweetloversrhythmrandomlistentiktokanyonereasonhomiesdrinksbottomcursedsearchfriendsmedicalhauntedhusbandcountryepisodewhisperdiamondtitanicjournalwebsitetwitterraggedyanythingbookworm...

the slanders word search 2025-04-11

11 Items: favorite hobbyyour birthstonethe puppers nameyour zodiac signwhere you grew upyour most used wordyour most worn colorone of ur fav sayingsyour favorite child’s namethe stare we get when ur angyshrinkos fav thing to say 2 ace

CRM 3.2 2025-01-17

19 Items: poetic paragraphsthe universal messagetwo lines of verse that rhymeA set of 2 lines, usually rhymingrhymes found at the end of a versewords or phrases that are repeated.Last name of the poet behind Romanticismrhymes found within a single line of versethe repetition of beginning consonant soundsWordsworth focused on this instead of "reason"...

Math 2025-10-09

14 Items: the backpropertylike termthe oppositeno equal signgiven or receiveadding a variablegetting the answercompares two equationbasic algebraic equationa value that won't changesomething to fill a questiona word with multiple meaning'ssomething with more that 3 or more equation

About Word Search 2025-03-25

76 Items: asbydogoifitmemynooforsotoupusallanydidhasherhimhisitsoneseetrytwousewhowhywonalsobeencallcomedoesdonedowneachfindgoodintoknowmademanymoremostonlyoverpartsaidsomethemtimeverywerewhatwhenwordworkyouraboutcouldfirstotherrightsmalltheirtherethesewaterwherewhichnumberpeopleshould

Wheelock's Chapter 5 Vocabulary 2025-11-13

25 Items: skywordwhenyouthglorycourageour (f)if everto dineto stayfree (m)tomorrowto blamethereforeyesterdaybecause ofto overcomemind, spiritfault, blamebeautiful (neut)sound, healthy (m)then, at that timeenough, sufficient(ly)you, yourself (acc/abl)[enclitic particle that denotes a question]

Word Search Competition 2025-11-25

79 Items: HotGasRedFunSunHeatColdJustMeltBlueCoreMarsMoonWordZoomReactScaleSolidStillFlameGreenCrustOceanEarthVenusPlutoExpandEnergyStatesLiquidUsefulYellowSaharaArcticRobloxMantleIndianSaturnUranusSearchCelsiusConductMeltingBoilingDisplayMixtureExplodePacificNeptuneJupiterMercuryExploreBecauseInsulateFreezingDiscoverZimbabweAsteroidThailandAtlanticRadiation...

Long i spelling- ZB 2023-11-15

5 Items: the opposite of day.a small, quiet animal.another word for okay, or good.you eat these, made from potatoes.feeling quiet and nervous to share.

Apparel and Textiles Objective 2.01 2025-05-13

32 Items: all stand and no fallenlarged up to the neckline portion.A single pleat turned in one direction.Set-In-Sleeves are sewn into an armhole.The zipper is compeltely cover with fabricshaped to fit the waist and slightly below.Two folds brought to a center point and pressed.has a separate neckband that serves as the stand....

Polydactyly 2025-05-14

6 Items: A felineEden's Polydactyly catAnother word for fingers or toesA man who loved Polydactyly catsA syndrom causing extra toes/digitsWhat Polydactyly syndrom causes extra of in cats

Family 2023-05-06

10 Items: the shy girlthe quirky kidthe energetic onehas big curly hairthe boss of the kidsthe boss of the housegets attacked by Brodythe strong and funny onewants to be the rich kidgoes outside and explore the word

Chapter 6 ED310 2023-02-14

10 Items: Data software______ ProcessingAllows ______ on documentsAssess the _______advantage_____lesson results and impactEncourages writing across the_________________dynamics within collaborative writingShare lessons, _______, and outcomes with other peer teachersTeachers create documents for instructions and _________ tasks...

Marie Curie 2025-12-05

9 Items: A type of prizeHer middle nameShe was born hereFirst field of studySecond field of studyFirst element she createdSecond element she createdEmissions from certain elementsA type of machine made during World Word One

Arianne Word Search 2024-10-23

15 Items: mebffmontanacapybarawhere im frommy dog's nameyoghurt and herbthe couch potatoeI "blank" you allthe name of our schoolthe meaning of my namewhat sofie says i havethe subject i hate the mostme and ariannes favorite thingthe word the boys are literally attracted too

English 1 Terms 2024-12-02

17 Items: __________ is the central idea___________ is a writer's attitude.The exact meaning of a word is _________.A sequence of events that make up a story.To illustrate is to show an ______________.______ is a transition for adding information.Something that stands for something is _________.Words that join other words are ________________....

ULTIMATE DISNEY MOVIE WORD SEARCH 2024-05-18

91 Items: UPBOLTCARSCOCOLUCASOULWISHBAMBIBRAVEDUMBOMOANAMULANFROZENONWARDPLANESTARZANWALL-EALADDINENCANTOTANGLEDDINOSAURFANTASIAHERCULESRESCUERSZOOTOPIABUGS LIFEELEMENTALENCHANTEDLIGHTYEARPETER PANPINOCCHIOLION KINGTOY STORYCINDERELLAINSIDE OUTPOCAHONTASROBIN HOODARISTOCATSGOOFY MOVIEINCREDIBLESMELODY TIMERATATOUILLEJUNGLE BOOKTURNING REDBIG HERO SIX...

AHA SLEEPOVER 2025 2025-12-11

15 Items: Mr Suleiman’s surnameUstadh Adam’s 3rd son’s nameName of Class of 2024 head boyWhat is Aliyu Tanko’s full nickname?Number of houses in Al-Hidaayah AcademyThis family have enrolled 5 kids in AHAWhat book do AHA students read in Year 8?The male companion green house is named after2026 is AHA’s ___________ year since opening....

Week 12 2023-05-17

15 Items: Another word for _________________ is new.I would love a ______________ pokemon doll!He _______________ the cookies for the party.Crabs and lobsters are ______________________.Their form of ____________________ is dancing.A cat in a tree writes _______________ for me.The water was too ______________ so I got sick....

Adult simp search 2024-04-26

9 Items: something you cravea personality traithow you should behavea term to describe youhow you should address mesomething you want to takesomething you do frequentlya word to describe your body partthe only way you get near a women

Vocabulary Vines 11-12 (Enright) 2025-09-11

13 Items: one rulerone, singlestudy of lifestudy of originsbelief in one godstudy of the earthspeech by one personstudy of the universemarried to one personspeech, study of, written wordstudy of ancient (first) peoplestudy of the distribution of waterwritten record of the time of events

Word Search About Us 2022-12-23

10 Items: My Middle name.Your last name.Our Secret word.Where I go to camp.Your favorite drink.Your favorite artist.One of my favorite colors.Colada My favorite drink.Jersey The State We live in.The area of our first date.. and where we go all the time.

Word Search About Us 2022-12-23

10 Items: My Middle name.Your last name.Our Secret word.My favorite drink.Where I go to camp.Your favorite drink.Your favorite artist.The State We live in.One of my favorite colors.The area of our first date.. and where we go all the time.

CS Word Search 2025-05-01

8 Items: Things we sayThe flag is hiddenThe type of class this isHypertext Markup LanguageThings saved on our computerA device that we use everydayThe command line interface on MACTaking plaintext and turning it into ciphertext

James 1 Word Search 2022-12-18

13 Items: God does not _______ anyone_______ triumphs over judgmentJames is the brother of _______The testing of our faith produces _______Every good and _______ gift is from aboveBelievers in Christ should not show _______Those who persevere will be given a _______ of lifeIf you lack _______, you should ask God to give it to you...

Happy Birthday Mom!! 2025-11-30

9 Items: 1 2 1 2 3New side questWe are _______ ____I am _____ wash my bellyGotta go get _____ __ _____Word for normal and regularShayna uses a ______ in dreamsMom uses the same piece of ____I hurt my wrists from doing ___ so much

LA 2025-01-31

24 Items: folkFableIronypeopleFluencyHomonymmeaningFairytaleHomophoneHyperboleInferencesJuxtaposedLiterature(to-too-two)or judgement based on evidenceword recognition, rapid decodingdifference between appearances and realitygenre includes stories, novels, poetry, and plays.international exaggeration for emphasis or comic relief...

Desserts Word Search 2023-08-13

6 Items: a young sheepopposite of cheapanother word for deliciousbeing the only one of its kindsomething that you use to buy thingssweet food eaten at the end of a meal

Back to school traditions 2023-08-13

6 Items: a young sheepopposite of cheapanother word for deliciousbeing the only one of its kindsomething that you use to buy thingssweet food eaten at the end of a meal

Saturn Word Search 2023-01-11

22 Items: moleculeWhat is "Sim"Moon of SaturnThe ringed planetGreek word for PhaseLiquid in Titan's lakeSpanish word for PhaseMethane is made of theseObserve with the naked eyeHelped Robert Boyle to measure air!How the appearance of a substance changesWhen either one goes up the other goes downHas no visible shape and fills its container....

related stuff 2024-07-04

2 Items: thisthe word is not there

Lion Word Search 2025-09-24

2 Items: A long wordAN African Animal

Greek and Latin Roots Unit 6 2025-09-29

10 Items: ritual chantcomparable tothorough reviewlosing fondness forto formally withdrawsimilarity of word soundshaving to do with sense of hearingso quiet as to be impossible to hearcommunication between two or more peoplea speech, passage, or event coming before the main speech or event

Disney 2025-09-26

1 Item: Stitch

Communications - Travel Automation 2025-04-29

11 Items: BA/Dev teamcustomized textPlan of the tripCost of the tripPDF/ Word extra filesNext meeting destinationIs on the top of the Itin/TRVisual of the travel receiptIs on the bottom of the Itin/TRGUI - Configuration Manager or ?Website to generate communication reports

Alphabet word search 2025-09-05

82 Items: atomcastdowndeskeachechofishfarmfiregamegiftgoldhandhillhomeideaironinchjumpjeepjoinkingkitekindlampleaflongmoonmilkminenamenestnoseovenopenovalparkpinkplayquizquitrainroadringshipsongstartreetentteamunituponuservasevoteverywallwindwordnexttaxiexityarnyardzerozoomzonexrayappleafterbrickcoverearthqueenxenonbananabehindcaughtyellowdependselephant...

Actividades 2024-10-07

27 Items: idwordseatreportnobodylockerprojectsomeoneon timethe rulescissorsto answermaterialsto respectto turn into explainto discusslaboratoryto memorizeit's forbiddento arrive lateto ask for helpto pay attentiontransparent tapeto ask a questiongrapadora staplerto get a good grade

Nouns 2025-10-06

80 Items: cardayendeyejobkidlawlotmanwayareabackbodybookcasecityfacefactgamehandheadhomehourideakindlifelinenamepartroomsideteamtimeweekwordworkyearchildgrouphouseissuelevelmoneymonthnightplacepointpowerrightstatestorystudythingwaterwomanworldfamilyfatherfriendmemberminutemothernumberothersparentpeopleschoolsystemcompanycountryproblemprogramservicestudent...

LATIN DAY 2023 WORD SEARCH 2023-04-29

80 Items: viaboywarsitseedognoxdaysunnewshiptreecasaroadgirlpuerbabybirdaviswalkhearwordmoonlunadiesstarpatermatermilesnavisnautaarborhousesedeoaudioteachdoceovideohorseequuscarryportocanisnightsolusearthterracoeloworldsmallgreatnovusfathermothersailorpuellainfansbellumchurchfarmerambulogaudeofamilyverbumstellaheavenmundusparvusmagnusgardenhortussoldier...

Super Puzzle 2025-12-17

81 Items: JoyPenInkLimeFireWindWoodHopeWordBookPageMindAppleGrapeMangoPeachLemonBerryRiverOceanBeachCloudStormWaterEarthStoneMetalGlassLightPowerFocusPeaceTrustDreamSmileLaughMagicLogicStoryPaperBrainBananaOrangeCherryIslandForestValleyDesertBreezeShadowMirrorEnergyGrowthWisdomWonderPuzzleNumberSymbolLetterMemoryRainbowThunderBalanceCourageFreedomJourney...

Blessed Word Search 2024-12-17

17 Items: an agreement with God and his peopleWill- The freedom and ability to choose(hint: What does the word Gospel mean?)- Good News(hint: What does the word Genesis mean?)- beginningA thought, word, deed, or omission against God's lawRevelation- God making himself known to us through creationan area in the Middle East that Include's present-day Israel...

Math Definitions 2023-06-11

17 Items: The answer to a division problem.the dependent quantity in a functionA list of numbers in a certain order.A list of numbers in a certain order.The word used to solve an expression.Determines the quantity of the output.The answer to a multiplication problem.You can use compatible numbers to __________....

Review with Clues 2024-01-24

23 Items: serfslavebudgetincomeexpensefeudalismamendmentthirteenthTribe of Kunta Kinte.Top of the Feudal System.Main character in the TV show Roots.Below a king, another word for Lord.Someone who pledges loyalty to another.Another name for the Atlantic Slave Trade. (Shape)Basic principles and rules that every human is born with....

Rebecca & Blair's Super Fun, Super Challenging Wedding Word Search 2025-09-18

21 Items: A fancier suit.A translucent accessory.The first event of today.Something better when open.A promise, but more serious.Selena Gomez' diamond shape.Something that was tied today.The job of two super cute nieces.Another word for a wedding ceremony.September 27, 2026 will be the first.Another word for "bachelorette" in the UK....

CannaChallenges 2023-11-27

6 Items: Type of nursing care for individuals using medical marijuanaExamples of these include drowsiness, restlessness, and changes in blood pressureA word to describe a nurse's role in helping patient's suffering from chronic painPrescribing Marijuana for chronic pain will potentially reduce the number of prescriptions of this medicine...

Narrative subgenres 2025-09-22

20 Items: Fairy tales charactersfirst German collectors of taleskind of narrator used in an epic storyThe main purpose of the narrative genrethe word myth comes from this Greek wordcentral theme of the epic poem Gilgameshstory about the lives and actions of godsfairy tale usually begins with this openerMinor subgenre that contains a moral lesson...

God Exists as Creator - Design #3 2025-11-12

12 Items: ________ 19:1.____________ 1:20.____________ 1:1-3.Six feet long in a cell.Every _________ has a designer.Every design has a ____________.Information comes from a _______.DNA is the recipe for p_ _ _ _ _ _.DNA is an alphabet of _____ letters.Proteins build ___________ in the body.We are fearfully and ____________________ made....

Dads world search 2022-11-06

11 Items: you are my...you are very...my big sis is...are dog is calledyou are a great...you are married to...i am your favourite...the longest word is...you love working in the...you love watching ...... on the TVmy nick name is... simpleton the cats nick name is

Places in Japan 2025-06-08

8 Items: the tallest mountaina very tall buildingthe place with red gatesthe place where they praythe tallest building in Tokyoyou can have lots of fun therethe Japanese word for red gatesthe place where kings and queens live

Career Opportunities and History of Esthetics 2025-02-20

6 Items: The study and treatment of cancer and tumorsGreek word meaning skilled in the use of cosmeticsThe integration of surgical procedures and esthetic treatmentsA dye obtained from the mignonette tree that is used as a reddish hair dye and temporary tattoo design...

Typhus Word Search 2022-11-16

34 Items: three dotsPost-war illnesspunctuation markSite of personalitySprouting seedlingssubtitle (one word)modern narrative stylemovie title (one word)Site of the Stone Dancetrigger of flight for coverSite of the nuclear accidentDirect opposite of somethingprotein one fears to consumeexperience of Charlotte Wolfdead fish that move when cut...

language arts 306 310 LR TB BT Top-left to bottom-right Bottom-left to top-right 2024-12-03

242 Items: inFr.frygalhrsminnorsecslyablearmyauntbasebeenbodycluedatedawnDec.elseevileverfizzflipfootgoeshalfhawkhe’sheldholdhoofI’veinchit’sI’veknewladylamblessLukemallmeanMissnearnewsOct.oncepairpastpearpintrealroseruleshowsizesurethawtoystripwarmwavewordzeroaloneblindbushycan’tchoseclimbcrumbdailydozenearlyextrafiftyfightfleshfloodgraceheardhearthellohow’s...

earth day word search 2023-04-13

5 Items: we live on ithow much energy we usebasically the first word backwardssomething that is making our earth badthe day we celebrate the planet we live on

Harbor Me Vocabulary Quiz 2025-04-10

27 Items: HeaterImperfectTo shelterSpanish word for riceSpanish word for pastryState of being never-endingThe act of coming back to lifePuerto Rican shaved ice dessertUncertain, indefinite, or unclearHaving been reborn in another bodyKilling of one person by another; murderOffering resistance to something or someone...

Industrial Revolution Word Search 2023-07-27

16 Items: jethro tull's stellar inventionjoseph foljambe helps farmers outa noun denoting a period of big changea problem with industrial revolution citiesa problem with industrial revolution citiesperson who introduced the dutch four-field systemsomething workers didn't really have at this timethis machine could work eight bolts of thread at once...

Penny Word Search 2025-12-18

18 Items: BabyOne cent coinA sweet treatEating outsideSinging snowmanAttractive metalSnakes and lizardsAntonym of outsideSmall hopping animalNot pay attention toBlood-sucking monsterRun away and get freeAnother word for a bugBreakfast food with syrupSmile to show this feelingSmall hopping animal, again!Sport with a fuzzy, yellow ball...

de Romanis November words 2025-11-15

33 Items: my10ournewboyseebuy100herehourgirlyearwordshowsmallthereneverplacereplysleepfirstfriendyoung mandon't ...high, deepnow, alreadyask, ask forwarn, adviseyour (sg), yoursyour (pl), yoursthus, in this wayand so, thereforehis / her / its / their (own)

Find the People 2022-07-29

88 Items: ofkimanaranoutwasnotandadammattmikeloriezrasethhardthiseasywordacdchulkthortrentrosiecarlatylerbobbycarolbrycenamessorrythinkcreedbandskelsiejaymesjaydenbaileymerlingerrodmeishaashleyautumnisabeljeremyrandomtandummakingmakinghiddenbatmanimdonemckennaselestemakaylaabigailchantilbelyndacouldntanymoreapologyelysiumkidrockdragonsigiveupsearchessuperman...

OUR ENVIRONMENT 2025-06-16

10 Items: keeps us warmwe all live on thismost of these are greenonly comes out at nightanother word for personyour dog is one of theselook up, what do you see?twinkle twinkle little _____its all around us but we can't see itfills up rivers, lakes, seas and oceans

ffa 2025-10-23

9 Items: An innovative deviceFuture farmers of americaAlong the lines of arguingSomewhere you go to competeAnother word for village or townPlanting or developing somethingSomething you can plant and harvestIf you have this people look up to youLearning through hands on opportunities

Force 2023-11-09

4 Items: you ____ a wagonyou ____ a friend on a swingThe title of this word searchyou move your legs; it is like running but slower

Colors! 2025-02-06

11 Items: The color of the skyThe color of most dirtThe color of fresh grassAnother word for purpuraThe color of an elephantThe color of most cloudsThe color of most carrotsThe color of ripe bananasThe color of most flamingosThe color of most firetrucksThe color of the street (mostly)

ENGLISH GRAMMAR WORD SEARCH PUZZLE 2025-08-05

10 Items: – Replaces a noun– Describes a noun– Expresses emotion– Used before nouns (a, an, the)– A person, place, thing, or idea– An action word or state of being– Connects words or groups of words– Shows direction, location, or time– Describes a verb, adjective, or adverb– Indicates time of action (past, present, future)

math word search 2025-10-08

11 Items: the oppositethe oppositewhat you solvethe final amountsomething that keeps goingto represent a word or phraseequations that have two stepswhat something is based off ofsigns you use to make equationsa term that continually keeps goingthe number to multiply by, also in science

merry christmas 2025-12-08

10 Items: first datemy step sonyour step sona word to describe youan artist we both lovewhat i ask for the mostmy favorite thing to dothe dog in our relationshipthe animal you remind me ofplace where you said i love you for the first time

FLYO 2025-02-07

2 Items: FLYTAILMURPHY TINY PINKY CHICKE STITCH BABYCHICKE BABYSTITCH CINNOMEN OTHER FLY ROLL CINOROLL DINOSAURRS T REX STEGO BRACKOSAURS VELOCIRAPTOR RRAPTOR OWEN CLAIE

Literary Terms Word Search 2024-03-19

10 Items: Four line stanza.Three line stanza.Repeating for emphasis.Words that imitate a sound.Giving human traits to animals.Giving human traits to objects.The dictionary definition of a word.Type of verse that has a set rhyme scheme.A thought, feeling, association behind words.Repetition of consonants at the beginning of words.